CX309306
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX309306 vs. ExPASy Swiss-Prot
Match: PPT1_CAEEL (Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2) HSP 1 Score: 71.633 bits (174), Expect = 3.199e-12 Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 3 Query: 30 ETSWFGYYPDGSFDPLLPAQQTQLYTEDWIGLKTLDEAGKVKFINVTGSHLEISRSDMKKYIV 218 ++SWFG+Y DG D +LP +T LY ED IGLK L E+G++ F++V G HL+I RS + I+ Sbjct: 231 DSSWFGFYKDGDIDTILPMNETDLYKEDRIGLKKLHESGRIHFMDVDGDHLQIPRSVLVNDII 293
BLAST of CX309306 vs. ExPASy Swiss-Prot
Match: PPT1_RAT (Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.457e-12 Identity = 30/67 (44.78%), Postives = 45/67 (67.16%), Query Frame = 3 Query: 30 ETSWFGYYPDGSFDPLLPAQQTQLYTEDWIGLKTLDEAGKVKFINVTGSHLEISRSDMKKYIVPYLK 230 ++ WFG+Y G +P Q+T LYTED +GLK +D+AGK+ F+ G HL+IS+ +I+P+LK Sbjct: 240 DSEWFGFYRSGQAKETIPLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHIIPFLK 306
BLAST of CX309306 vs. ExPASy Swiss-Prot
Match: PPT1_MOUSE (Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 1.588e-11 Identity = 29/67 (43.28%), Postives = 45/67 (67.16%), Query Frame = 3 Query: 30 ETSWFGYYPDGSFDPLLPAQQTQLYTEDWIGLKTLDEAGKVKFINVTGSHLEISRSDMKKYIVPYLK 230 ++ WFG+Y G +P Q++ LYTED +GLK +D+AGK+ F+ G HL+IS+ +I+P+LK Sbjct: 240 DSEWFGFYRSGQAKETIPLQESTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHIIPFLK 306 The following BLAST results are available for this feature:
BLAST of CX309306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX309306 ID=CX309306; Name=CX309306; organism=Citrus clementina; type=EST; length=590bpback to top |