DY258030

Overview
NameDY258030
Unique NameDY258030
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1013
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 2.573e-127
Identity = 207/250 (82.80%), Postives = 226/250 (90.40%), Query Frame = 2
Query:   83 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATVFAAFTPQ 832
            QK+ S+ GATKASF            A  G+RSV+VSA AADP+RPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPE+L+WN Q+E+VH RWAMLGAAGIFIPE LTK+G+LNTPSWYTAGE EYFTDTTTLF++E++ IGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSP K+KELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNL AHLADPGHAT+FAAF+P+
Sbjct:   21 QKNGSIVGATKASFLGGKRLRVSKFIAPVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFSPK 270          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 1.012e-123
Identity = 203/250 (81.20%), Postives = 219/250 (87.60%), Query Frame = 2
Query:   83 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATVFAAFTPQ 832
            +++ S+ G TKASF             T   RS +    AADP+RPLWFPGSTPP WLDGSLPGDFGFDPLGL SDPE+LRWN Q+E+VHCRWAMLGAAGIFIPELLTK+GILNTPSWYTAGE EYFTDTTTLFIVE++ IGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSP K+KELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNL AHLADPGHAT+FAAF+P+
Sbjct:   21 RRNGSIVGTTKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFSPK 270          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 8.167e-57
Identity = 106/196 (54.08%), Postives = 131/196 (66.84%), Query Frame = 2
Query:  224 WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATV 811
            W PG   P +L GSLPGD GFDPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE+ T +GI+N P WY AG+ EYF  ++TLF++E I   + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +         E + KEI NGRLAMLA +G   QH  TG GP DNL+ H++DP H T+
Sbjct:   56 WLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGI-FNPLNFA-----PTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTI 245          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 8.167e-57
Identity = 106/215 (49.30%), Postives = 139/215 (64.65%), Query Frame = 2
Query:  179 SVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATVFAAF 823
            S   S+   +  +  W PG   P++L GSL GD GFDPLGL  DPE L+W VQ+E+V+ RWAMLG AG+ +PE+ TK+GI+N P WY AG+ +YF  ++TLF++E I   + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +        +E + KE+ NGRLAMLA +G   QH  TG GP +NL+ HL+DP H T+   F
Sbjct:   42 SAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGI-FNPLNFA-----PTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTF 250          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 6.486e-46
Identity = 105/220 (47.73%), Postives = 132/220 (60.00%), Query Frame = 2
Query:  176 RSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWY-TAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATVFAAFTPQ 832
            R V+V A  +      W PG   P +LDGSL GD GFDPL L  DPE LRW VQ+++V+ RWAMLG AG+ IPE+LTK G++N P W    G+  YF  ++T   V M    + E RRW DI  PG VN DPIF +  L   + GYPG + F+PL +   +P + KE   KE+ NGRLAMLA +G   QH   G GP +NL  HLADP H T+    + Q
Sbjct:   26 RDVAVQAKGS------WLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSST-YVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGRV-FNPLNF---APLENKE---KELANGRLAMLAFLGFLVQHNVHGKGPFENLQQHLADPWHNTIIQTISGQ 231          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.953e-42
Identity = 101/232 (43.53%), Postives = 132/232 (56.90%), Query Frame = 2
Query:  176 RSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWYT------AGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT--DVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATVFAA 820
            R+ S        NR LWF       +LDG LPGDFGFDPLGL SDPE        +W    E+++ R+AMLGAAG   PE+L K G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D  KPG +         K  G   D  YPGG  F+PLG+G    + +KEL+ KEIKNGRLAMLA++G + Q + TG GP  NL+ HLADP +  V  +
Sbjct:   40 RAASTPPVKQGANRQLWFASKQSLSYLDGRLPGDFGFDPLGL-SDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDE-KSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTS 269          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 4.351e-42
Identity = 102/239 (42.68%), Postives = 138/239 (57.74%), Query Frame = 2
Query:  173 TRSVSVSAAAADP------NRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWYT------AGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT--DVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATVFAA 820
            +R   V AAA  P      +RPLWF       +LDGSLPGD+GFDPLGL SDPE        RW    E+++ R+AMLGA G   PE L K+G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D  KPG +         K  G   +  YPGG +F+PLG+G    + +KEL+ KE+KNGRLAMLA++G + Q + TG GP  NL+ H+ADP +  V  +
Sbjct:   35 SRKGLVRAAATPPVKQGGVDRPLWFASKQSLSYLDGSLPGDYGFDPLGL-SDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDE-KSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTS 271          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.692e-33
Identity = 88/205 (42.93%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  224 WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA--GELEY------FTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQH-IYTGTGPIDNLIAHLADPGHATV 811
            WFPG   P  LDGS PGDFGFDPLGL + PE      +SEI HCRWAML   G+ +PE L     +    W     G+  Y      + +  T+  +E + I +AE +R         +  DP             YPGG  FDPLG+ S  P K +EL+ KEIKNGRLAMLA +G   Q   Y GTGP++NL  HLADP H  +
Sbjct:   48 WFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQR--------TMEKDP---------EKKKYPGGA-FDPLGF-SKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 233          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 4.821e-33
Identity = 84/212 (39.62%), Postives = 108/212 (50.94%), Query Frame = 2
Query:  224 WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSW--YTAGELEYFTDTT------TLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQH-IYTGTGPIDNLIAHLADPGHATVFAAFTPQ 832
            W PG   P +LDGS PGDFGFD LGLG  P  L    +SE++HCRWAML   GI +PE L     +    W     G+  Y           T+  +E + I + E +R                 + +       YPGG  FDPLG+ S  P K +EL+ KEIKNGRLA+LA++G   Q   Y GTGP++NL  HLADP H  +     P+
Sbjct:   49 WMPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQR-----------------SMEKDSEKKKYPGGA-FDPLGY-SKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNNIGDVIIPK 241          
BLAST of DY258030 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 1.074e-32
Identity = 94/234 (40.17%), Postives = 125/234 (53.42%), Query Frame = 2
Query:  167 AGTRSVSVSAAAAD---PNRPLW---FPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGI-LNTPSWYTAGE-------LEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPGHATVFAAFT 826
            A T+ ++ SA+ +    P+R L+   F G  PP +L G  PGD+G+D  GL +DPE    N + E++HCRWAMLGA G   PELL + G+      W+ AG        L+Y  + + +    ++ I WA       +I  G V    I        TD  YPGG  FDPLG     PE   EL+ KEIKNGRLAM ++ G + Q I TG GPI+NL  HLADP +   +A  T
Sbjct:   44 ATTKKLTASASTSPWYGPDRVLYLGPFSGE-PPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAI-WA-----CQVILMGAVEGYRIAGGPLGEVTDPIYPGGS-FDPLGLAE-DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYAT 268          
The following BLAST results are available for this feature:
BLAST of DY258030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB12_PETHY2.573e-12782.80Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC1.012e-12381.20Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA8.167e-5754.08Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB24_ARATH8.167e-5749.30Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB120_HORVU6.486e-4647.73Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB13_SOLLC1.953e-4243.53Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB23_PEA4.351e-4242.68Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB121_HORVU3.692e-3342.93Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB11_SOLLC4.821e-3339.62Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB2B_PINSY1.074e-3240.17Chlorophyll a-b binding protein type 2 member 1B, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2CH01ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258030 ID=DY258030; Name=DY258030; organism=Citrus clementina; type=EST; length=1013bp
GGCTGAAAGCCTTTGCTTGGTAGTAAAAATGGCTTCCGTTTGTGCTTCCC
CTGCCGTTGCAGCCATCTCATCCCCCAGTTCTCAGAAGAGTAGATCAGTT
GCGGGAGCAACAAAGGCTTCTTTCCTTGGTGGGAAGAAGCTGAAATTGAG
AAAAAACGGAGCAACAGCGGGAACACGATCGGTTTCAGTGAGTGCGGCTG
CAGCTGATCCTAACAGGCCTCTCTGGTTCCCAGGCAGCACTCCTCCTGAA
TGGCTCGATGGTAGCCTCCCCGGAGACTTCGGCTTCGATCCTCTTGGTCT
TGGATCTGATCCTGAGACGCTGAGATGGAACGTGCAATCAGAAATTGTGC
ACTGCAGATGGGCAATGTTAGGAGCTGCAGGAATTTTCATTCCGGAATTG
TTAACAAAACTTGGAATCCTCAACACTCCATCCTGGTACACAGCTGGGGA
GCTAGAGTACTTCACAGACACCACCACCCTGTTCATTGTTGAGATGATAT
TCATAGGCTGGGCAGAGGGCAGACGGTGGGCCGACATTATAAAGCCAGGC
TGTGTGAACACTGACCCGATCTTCCCCAACAACAAGCTCACCGGCACCGA
TGTTGGGTACCCAGGTGGGCTTTGGTTTGACCCACTTGGCTGGGGATCCG
GTTCGCCCGAGAAGGTAAAGGAGCTGAGGACTAAGGAGATCAAGAATGGA
AGATTGGCTATGTTGGCTGTGATGGGTGCTTGGTTCCAGCACATTTACAC
CGGCACCGGCCCCATTGACAATCTCATTGCCCACCTTGCTGATCCTGGTC
ATGCCACCGTTTTTGCTGCCTTCACCCCCCAGTGAGATGATGACGAGCAA
AGGGAGAGAAATTTGGGCCAAGAGGAAGCTTGAGATCAAAGGAATTGGTG
TTTCCCTTAAGGAAAAGTTGTATGATTAGAACTTGTATTAATTGCCTCTA
TCTATGTACCAAGACTTGGGTGATCACCTTAGATGCCATGAATATAAAAA
AATATTCAGGGGG
back to top