DY258283

Overview
NameDY258283
Unique NameDY258283
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length680
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1066 contig Ccv1_Contig1066:1..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL_PHAAU (V-type proton ATPase 16 kDa proteolipid subunit OS=Phaseolus aureus PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.831e-46
Identity = 101/130 (77.69%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRAD
Sbjct:   35 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD 164          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL_MESCR (V-type proton ATPase 16 kDa proteolipid subunit OS=Mesembryanthemum crystallinum GN=VMAC1 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.831e-46
Identity = 101/130 (77.69%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRAD
Sbjct:   36 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD 165          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL_KALDA (V-type proton ATPase 16 kDa proteolipid subunit OS=Kalanchoe daigremontiana PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.831e-46
Identity = 101/130 (77.69%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRAD
Sbjct:   36 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD 165          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL_BETVU (V-type proton ATPase 16 kDa proteolipid subunit OS=Beta vulgaris GN=VMAC1 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.831e-46
Identity = 101/130 (77.69%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRAD
Sbjct:   36 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD 165          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL_GOSHI (V-type proton ATPase 16 kDa proteolipid subunit OS=Gossypium hirsutum GN=CVA16-2 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.696e-45
Identity = 100/130 (76.92%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRA+
Sbjct:   36 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE 165          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL4_ARATH (V-type proton ATPase 16 kDa proteolipid subunit c4 OS=Arabidopsis thaliana GN=VHA-C4 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.696e-45
Identity = 100/130 (76.92%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRA+
Sbjct:   37 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE 166          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL2_ARATH (V-type proton ATPase 16 kDa proteolipid subunit c2 OS=Arabidopsis thaliana GN=VHA-C2 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.696e-45
Identity = 100/130 (76.92%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRA+
Sbjct:   36 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE 165          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL1_ARATH (V-type proton ATPase 16 kDa proteolipid subunit c1/c3/c5 OS=Arabidopsis thaliana GN=VHA-C1 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.696e-45
Identity = 100/130 (76.92%), Postives = 101/130 (77.69%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRA+
Sbjct:   35 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE 164          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL_ORYSJ (V-type proton ATPase 16 kDa proteolipid subunit OS=Oryza sativa subsp. japonica GN=VATP-P1 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.216e-45
Identity = 100/130 (76.92%), Postives = 100/130 (76.92%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK YYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRAD
Sbjct:   36 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD 165          
BLAST of DY258283 vs. ExPASy Swiss-Prot
Match: VATL_ORYSI (V-type proton ATPase 16 kDa proteolipid subunit OS=Oryza sativa subsp. indica GN=VATP-P1 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.216e-45
Identity = 100/130 (76.92%), Postives = 100/130 (76.92%), Query Frame = 1
Query:    1 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYXXXXXXXXXXXXXXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRAGQSRAD 390
            KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK YYLFDGY                 MAIGIVGDAGVRANAQQPKLFVGM            YGLIVGIILSSRAGQSRAD
Sbjct:   36 KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD 165          
The following BLAST results are available for this feature:
BLAST of DY258283 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
VATL_PHAAU5.831e-4677.69V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
VATL_MESCR5.831e-4677.69V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
VATL_KALDA5.831e-4677.69V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
VATL_BETVU5.831e-4677.69V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
VATL_GOSHI1.696e-4576.92V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
VATL4_ARATH1.696e-4576.92V-type proton ATPase 16 kDa proteolipid subunit c4... [more]
VATL2_ARATH1.696e-4576.92V-type proton ATPase 16 kDa proteolipid subunit c2... [more]
VATL1_ARATH1.696e-4576.92V-type proton ATPase 16 kDa proteolipid subunit c1... [more]
VATL_ORYSJ2.216e-4576.92V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
VATL_ORYSI2.216e-4576.92V-type proton ATPase 16 kDa proteolipid subunit OS... [more]

Pages

back to top
Libraries
Library NameType
AbsDev1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAI1AA04FM2 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258283 ID=DY258283|Name=DY258283|organism=Citrus clementina|type=EST|length=680bp
AAGAGTGGTGTTGGTGTGGCGTCAATGGGTGTTATGAGGCCTGAGCTGGT
GATGAAGTCGATTGTGCCAGTTGTTATGGCTGGTGTTTTGGGTATATATG
GTTTGATTATTGCTGTTATTATCAGTACTGGGATTAACCCCAAGGCCAAG
TCATATTACCTTTTTGATGGCTATGCTCATCTCTCCTCCGGTTTGGCTTG
TGGTCTTGCCGGGCTTTCTGCTGGAATGGCTATTGGAATCGTTGGTGACG
CTGGTGTCAGAGCCAATGCACAGCAGCCAAAACTCTTTGTTGGGATGATC
CTTATCCTCATTTTCGCTGAAGCCCTTGCACTGTATGGCCTTATTGTTGG
TATCATCTTGTCTTCACGTGCTGGTCAGTCCAGAGCAGATTAAGAAGGGA
ATTTGTATTGCTAAGTATTCTTTTATAACTTGTCACTCTGGGGGAGCGAG
ATTTTTTTTAAATTATTCTCAGGTTCAAGTGGATAGCACTTGCTCAAAAT
TTCTTGTGGAAGTTGCCGTTCTGCGAGTCATTTGTATGTTACTCCATGTT
TCTGGTAGTAGGATTGAGTTTCTTCAAACAATAAAGTTTGCAAAGCTGTC
CATGCACTTTTGCAGAACTTTAACTGTCAGAAAGGAATTTTATTCGGTAA
TCTAGTGCATGTATTATCCTATTATCTATT
back to top