DY259729

Overview
NameDY259729
Unique NameDY259729
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length629
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14233 contig Ccv1_Contig14233:26..654. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: R35A1_ARATH (60S ribosomal protein L35a-1 OS=Arabidopsis thaliana GN=RPL35AA PE=3 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 6.997e-56
Identity = 103/112 (91.96%), Postives = 106/112 (94.64%), Query Frame = 3
Query:   54 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSL+QVEGVNT EEV+WY GKR+AYIYKAKTKKNGSHYRCIWGKV R HGNSGVVRAKF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVSWYKGKRMAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: R35A3_ARATH (60S ribosomal protein L35a-3 OS=Arabidopsis thaliana GN=RPL35AC PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.193e-55
Identity = 102/112 (91.07%), Postives = 106/112 (94.64%), Query Frame = 3
Query:   54 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSL+Q+EGVNT+EEV WY GKR+AYIYKAKTKKNGSHYRCIWGKV R HGNSGVVRAKF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: R35A2_ARATH (60S ribosomal protein L35a-2 OS=Arabidopsis thaliana GN=RPL35AB PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.251e-54
Identity = 100/111 (90.09%), Postives = 105/111 (94.59%), Query Frame = 3
Query:   57 VKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            +KGRQGERVRLYVRGT+LGYKRSKSNQYPNTSLIQ+EGVNT+EEV WY GKRLAYIYKAKTKKNGSHYRCIWGKV R HGNSGVVR+KF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVNWYKGKRLAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: R35A4_ARATH (60S ribosomal protein L35a-4 OS=Arabidopsis thaliana GN=RPL35AD PE=3 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 2.940e-54
Identity = 99/111 (89.19%), Postives = 105/111 (94.59%), Query Frame = 3
Query:   57 VKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            +KGRQGERVRLYVRGT+LGYKRSKSNQYPNTSL+Q+EGVNT+EEV WY GKRLAYIYKAKTKKNGSHYRCIWGKV R HGNSGVVR+KF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRLAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: RL33B_YEAST (60S ribosomal protein L33-B OS=Saccharomyces cerevisiae GN=RPL33B PE=1 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 4.275e-29
Identity = 60/105 (57.14%), Postives = 77/105 (73.33%), Query Frame = 3
Query:   75 ERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            E  RLYV+G  L Y+RSK    PN SLI++EGV T +E  +Y GKR+AY+Y+A  +  GS  R +WGKV R+HGNSGVVRA F++NLP K+ G  VR+F+YPSNI
Sbjct:    3 ESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQEAQFYLGKRIAYVYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI 107          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: RL33A_YEAST (60S ribosomal protein L33-A OS=Saccharomyces cerevisiae GN=RPL33A PE=1 SV=3)

HSP 1 Score: 126.716 bits (317), Expect = 9.523e-29
Identity = 59/105 (56.19%), Postives = 77/105 (73.33%), Query Frame = 3
Query:   75 ERVRLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            E  RLYV+G  L Y+RSK    PN SLI++EGV T ++  +Y GKR+AY+Y+A  +  GS  R +WGKV R+HGNSGVVRA F++NLP K+ G  VR+F+YPSNI
Sbjct:    3 ESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAYVYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI 107          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: RL33A_SCHPO (60S ribosomal protein L33-A OS=Schizosaccharomyces pombe GN=rpl33a PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 4.423e-26
Identity = 53/102 (51.96%), Postives = 73/102 (71.57%), Query Frame = 3
Query:   84 RLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            RLYV+   L ++RSK   +P TSL+++EG ++KEE  +Y GKR+ ++YK+     GS  R IWG V+R HGNSGVVRA+F  NLPPK+ G  +RV +YPSN+
Sbjct:    7 RLYVKAKHLSFQRSKHVIHPGTSLVKIEGCDSKEEAQFYLGKRICFVYKSNKPVRGSKIRVIWGTVSRPHGNSGVVRARFTHNLPPKTFGASLRVMLYPSNV 108          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: RL35A_DICDI (60S ribosomal protein L35a OS=Dictyostelium discoideum GN=rpl35a PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 9.854e-26
Identity = 51/103 (49.51%), Postives = 80/103 (77.67%), Query Frame = 3
Query:   84 RLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYK-AKTKKNGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            ++Y +G +LGY+RS++ QYPN SLI++EGV ++E+  +Y GK++  + K +K+ KN + ++  WGK+ ++HG+SGVV+A+F  NLPPK+MG  VRV +YPSNI
Sbjct:    3 KIYSKGVVLGYRRSQATQYPNISLIKIEGVVSREDSTFYLGKKVCLVSKVSKSAKNPTGHKISWGKICKTHGSSGVVQARFARNLPPKAMGAPVRVMLYPSNI 105          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: RL35A_XENLA (60S ribosomal protein L35a OS=Xenopus laevis GN=rpl35a PE=3 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.195e-25
Identity = 55/107 (51.40%), Postives = 74/107 (69.16%), Query Frame = 3
Query:   84 RLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKK-----NGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            RL+ + T  GYKR   NQ  +T+L+++EGV  ++E  +Y GKR AY+YKAK          +  R IWGKV R+HGNSG+VRAKF+SNLP K++G R+RV +YPS I
Sbjct:    4 RLWCKATFAGYKRGLRNQREHTALLKIEGVYARDETEFYFGKRCAYVYKAKNNTVTPGGKPNRTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI 110          
BLAST of DY259729 vs. ExPASy Swiss-Prot
Match: RL35A_ICTPU (60S ribosomal protein L35a OS=Ictalurus punctatus GN=rpl35a PE=3 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.867e-25
Identity = 56/107 (52.34%), Postives = 74/107 (69.16%), Query Frame = 3
Query:   84 RLYVRGTILGYKRSKSNQYPNTSLIQVEGVNTKEEVAWYCGKRLAYIYKAKTKK-----NGSHYRCIWGKVARSHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 389
            RL+ +    GYKR   NQ  +T+L++VEGV ++ EV +Y GKR AY+YKAK          +  R IWGKV R+HGNSG+VRAKF SNLPPK++G R+RV +YPS +
Sbjct:    4 RLWCKAIFAGYKRGLRNQREHTALLKVEGVYSRNEVDFYLGKRCAYVYKAKKTTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFTSNLPPKAIGHRIRVMLYPSRV 110          
The following BLAST results are available for this feature:
BLAST of DY259729 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
R35A1_ARATH6.997e-5691.9660S ribosomal protein L35a-1 OS=Arabidopsis thalia... [more]
R35A3_ARATH1.193e-5591.0760S ribosomal protein L35a-3 OS=Arabidopsis thalia... [more]
R35A2_ARATH2.251e-5490.0960S ribosomal protein L35a-2 OS=Arabidopsis thalia... [more]
R35A4_ARATH2.940e-5489.1960S ribosomal protein L35a-4 OS=Arabidopsis thalia... [more]
RL33B_YEAST4.275e-2957.1460S ribosomal protein L33-B OS=Saccharomyces cerev... [more]
RL33A_YEAST9.523e-2956.1960S ribosomal protein L33-A OS=Saccharomyces cerev... [more]
RL33A_SCHPO4.423e-2651.9660S ribosomal protein L33-A OS=Schizosaccharomyces... [more]
RL35A_DICDI9.854e-2649.5160S ribosomal protein L35a OS=Dictyostelium discoi... [more]
RL35A_XENLA2.195e-2551.4060S ribosomal protein L35a OS=Xenopus laevis GN=rp... [more]
RL35A_ICTPU2.867e-2552.3460S ribosomal protein L35a OS=Ictalurus punctatus ... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA07FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259729 ID=DY259729|Name=DY259729|organism=Citrus clementina|type=EST|length=629bp
CTTCTTTGCAGACTCAGGCGGCAAGCAGGTGGGCAGAGCTTCAATCATAA
ACAATGGTGAAGGGCAGGCAAGGCGAGCGCGTCAGACTCTATGTTCGAGG
AACAATTCTGGGATACAAAAGGTCAAAATCAAACCAGTATCCAAACACAT
CACTGATTCAGGTCGAGGGAGTTAACACAAAGGAAGAGGTGGCGTGGTAC
TGCGGCAAGCGTTTGGCTTACATTTACAAGGCCAAGACTAAGAAGAACGG
ATCCCACTACCGTTGTATTTGGGGAAAAGTTGCCAGATCTCACGGTAACA
GCGGCGTCGTTCGCGCCAAGTTCAAGTCCAATCTCCCTCCCAAATCCATG
GGAGATAGAGTTAGGGTTTTCATGTATCCCAGCAACATATGAGCAGCATG
GTTCGAGAAGCTACTCGATCAACAAGTGAAATGTGCCTTCTGAATTTGGG
ATTTATTCGCTTAACATTTATGTTGCAAGATTTTGGAGTTGGGAGTTATA
CTGGCTAGATGTTTTGGCTTTTGCTACTGTTAGTGTGGATTTTGGAACAT
TAATTTTAATGTTAATGCTTAGTTTTTTGTTTTGAATTTTTTCTATCATG
ATAATGAATTTACTTTATCATTTACCCTT
back to top