DY259735

Overview
NameDY259735
Unique NameDY259735
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1030
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9399 contig Ccv1_Contig9399:124..1153. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: MTDH_FRAAN (Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 8.310e-75
Identity = 111/175 (63.43%), Postives = 128/175 (73.14%), Query Frame = 1
Query:    7 EEEHPVKAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            E+EH  KA GWAARDSSG LSPF F RRETG++DV  KVLYCGICH+DL  +KNEWGFS +P+VPGHEI GEVTE                     +C SCE+C + LENYCPK ILTY +   DG+ TYGGYSD MVA+E +IVR PD++PLD AAPLLCAGIT YSPL+YFGL
Sbjct:    4 EQEHRKKASGWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGFSTYPLVPGHEIVGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPKQILTYGAKYYDGSTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGL 178          

HSP 2 Score: 66.6254 bits (161), Expect = 8.310e-75
Identity = 43/104 (41.35%), Postives = 58/104 (55.77%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL-TXXXXXXXXXXXXSIKFPGQLGSGCAPNTPPTYLEFP-NMGKKKGSGTPPG 896
            +FAKA G KVTVISTSP ++ E L+HLG DSFL +RD +Q+Q A+ T  G++ T             +   G+L    AP  P     FP  MG+K  +G+  G
Sbjct:  199 KFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDQMQAAIGTMDGIIDTVSAQHPLLPLIGLLNSHGKLVMVGAPEKPLELPVFPLLMGRKMVAGSGIG 302          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: MTDH_MESCR (Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.013e-73
Identity = 110/175 (62.86%), Postives = 124/175 (70.86%), Query Frame = 1
Query:    7 EEEHPVKAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            E  HP KAFGWAARD+SG LSP KFSRR TG++DV  KVLYCGICH+DL  IKNEWG +++P +PGHEI G VTE                     +C SCESC N LENYCPKMILTY S   DGT+TYGGYSD MV  E + VR PD+M LDA APLLCAG+TVYSPLK+F L
Sbjct:    7 ENVHPQKAFGWAARDTSGTLSPLKFSRRATGEQDVTFKVLYCGICHSDLHYIKNEWGNAVYPAIPGHEIVGVVTEVGNKVQNFKVGDKVGVGCMVGSCRSCESCENHLENYCPKMILTYGSTYYDGTLTYGGYSDIMVVEEHFAVRIPDNMALDATAPLLCAGVTVYSPLKHFEL 181          

HSP 2 Score: 66.6254 bits (161), Expect = 2.013e-73
Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL 746
            +F KAFGAKVTVISTSP++K E +  LG DSF+ +R+PEQ+Q AM T  G++
Sbjct:  202 KFGKAFGAKVTVISTSPNKKDEAVNRLGADSFVVSREPEQMQSAMGTLDGII 253          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: MTDH_MEDSA (Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.838e-71
Identity = 103/179 (57.54%), Postives = 131/179 (73.18%), Query Frame = 1
Query:    1 SREEEHPVKAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGLAE 537
            S E E P+KAFGWAARD+SG LSPF FSRRE GD+DV +K+LYCG+CH+DL  +KN+WGF+ +P+VPGHEI G VT+                     +C +CE+C  DLE YCPK + TY+S    GT TYGGYSD +V ++RY+V+FPD++PLDA APLLCAGITVYSP+KY+G+ E
Sbjct:    4 SPETELPLKAFGWAARDTSGTLSPFHFSRRENGDDDVSVKILYCGVCHSDLHTLKNDWGFTTYPVVPGHEIVGVVTKVGINVKKFRVGDNVGVGVIVESCQTCENCNQDLEQYCPKPVFTYNS-PYKGTRTYGGYSDFVVVHQRYVVQFPDNLPLDAGAPLLCAGITVYSPMKYYGMTE 181          

HSP 2 Score: 64.3142 bits (155), Expect = 1.838e-71
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL-TXXXXXXXXXXXXSIKFPGQLGSGCAPNTPPTYLEFPNMGKKK 875
            +F KAFG KVTVISTSP+++TE ++ LG DSFL ++DPE+++ AM T   ++ T             +K  G+L +   P+ P     FP +  +K
Sbjct:  200 KFGKAFGLKVTVISTSPNKETEAIDKLGADSFLVSKDPEKMKAAMGTMDYIIDTISAAHSLMPLLGLLKLNGKLVTVGLPSKPLELSVFPLVAGRK 295          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: GEDH1_OCIBA (Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 5.802e-70
Identity = 104/177 (58.76%), Postives = 124/177 (70.06%), Query Frame = 1
Query:    1 SREEEHPVKAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            S E EHPVKA GWAA D+SG  SPF FSRR TG+ DV+ +VLYCG+CH+DL  +KNEWG + +P+VPGHEI G VTE                     +C  C+ C+NDLENYC K ILTY +   DGTI  GGYSD MVA+E +I+R+P++ PLDA APLLCAGIT YSPLKYFGL
Sbjct:    4 SPETEHPVKALGWAATDNSGTFSPFNFSRRATGERDVQFRVLYCGVCHSDLHMVKNEWGVTHYPIVPGHEIVGIVTEVGSKVEKVKIGDKVGVGVLVGSCRQCDQCSNDLENYCYKQILTYGAPYLDGTIARGGYSDIMVADEHFIIRWPENFPLDAGAPLLCAGITTYSPLKYFGL 180          

HSP 2 Score: 62.7734 bits (151), Expect = 5.802e-70
Identity = 29/52 (55.77%), Postives = 40/52 (76.92%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL 746
            +FAKAFG KVTVISTS S+K E ++HLG D F+ + DP+Q+Q A+ T  G++
Sbjct:  201 KFAKAFGTKVTVISTSLSKKEEAMQHLGVDEFVVSTDPQQMQAAVGTLDGII 252          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: CADH6_ARATH (Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 8.254e-69
Identity = 106/177 (59.89%), Postives = 132/177 (74.58%), Query Frame = 1
Query:    1 SREEEHPVKAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            S E+E  V+AFGWAARDSSGHLSPF FSRR+TG+E+VR+KVLYCGICH+DL  +KNEW  S++P+VPGHEI GEV+E                     +C +CESC  D ENYC K I TY+ ++ DGTI YGGYSDH+V +ERY V+ P ++PL +AAPLLCAGI++YSP+KYFGL
Sbjct:    5 SGEKEQSVEAFGWAARDSSGHLSPFVFSRRKTGEEEVRVKVLYCGICHSDLHCLKNEWHSSIYPLVPGHEIIGEVSEIGNKVSKFNLGDKVGVGCIVDSCRTCESCREDQENYCTKAIATYNGVHHDGTINYGGYSDHIVVDERYAVKIPHTLPLVSAAPLLCAGISMYSPMKYFGL 181          

HSP 2 Score: 51.6026 bits (122), Expect = 8.254e-69
Identity = 23/52 (44.23%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL 746
            +FAKAFG KVTV+S++  +  + L+ LG D FL + D +Q++ AM T  G++
Sbjct:  202 RFAKAFGTKVTVVSSTTGKSKDALDTLGADGFLVSTDEDQMKAAMGTMDGII 253          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: CADH9_ARATH (Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=1 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 5.294e-68
Identity = 98/179 (54.75%), Postives = 129/179 (72.07%), Query Frame = 1
Query:    1 SREEEHPVKAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGLAE 537
            S E EHP K FGW ARD SG LSPF FSRR+ G+ DV +K+L+CG+CHTDL  IKN+WG+S +P+VPGHEI G  T+                     +C SCESC  DLENYCP+M  TY++I +DGT  YGGYS+++V ++R+++RFP+++P D+ APLLCAGITVYSP+KY+G+ E
Sbjct:    4 SPETEHPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPVVPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIGSDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMTE 182          

HSP 2 Score: 53.9138 bits (128), Expect = 5.294e-68
Identity = 36/104 (34.62%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL-TXXXXXXXXXXXXSIKFPGQLGSGCAPNTPPTYLEFP-NMGKKKGSGTPPG 896
            +  KAFG KVTVIS+S ++  E + HLG DSFL T DP++++ A+ T   ++ T             +K  G+L +   P  P     FP  +G+K   G+  G
Sbjct:  201 KIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQKMKAAIGTMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVG 304          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: CADH8_ARATH (Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.174e-67
Identity = 101/169 (59.76%), Postives = 121/169 (71.60%), Query Frame = 1
Query:   25 KAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            +AFG AA+D+SG LSPF F+RRETG++DVR KVL+CGICH+DL  +KNEWG S +P+VPGHEI G VTE                     +C SC+SC   +ENYCPK I TY     D TITYGGYSDHMV  E +++R PD++PLDAAAPLLCAGITVYSP+KY GL
Sbjct:    8 EAFGLAAKDNSGVLSPFSFTRRETGEKDVRFKVLFCGICHSDLHMVKNEWGMSTYPLVPGHEIVGVVTEVGAKVTKFKTGEKVGVGCLVSSCGSCDSCTEGMENYCPKSIQTYGFPYYDNTITYGGYSDHMVCEEGFVIRIPDNLPLDAAAPLLCAGITVYSPMKYHGL 176          

HSP 2 Score: 60.8474 bits (146), Expect = 1.174e-67
Identity = 38/92 (41.30%), Postives = 51/92 (55.43%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL-TXXXXXXXXXXXXSIKFPGQLGSGCAPNTPPTYLEFPNM 863
            +FAKA G KVTVISTS  ++ E +  LG D+FL +RDP+Q++ AM T  G++ T             +K  G+L    AP  P   LE P M
Sbjct:  197 KFAKAMGTKVTVISTSEKKRDEAINRLGADAFLVSRDPKQIKDAMGTMDGIIDTVSATHSLLPLLGLLKHKGKLVMVGAPEKP---LELPVM 285          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: MTDH_APIGR (Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 5.773e-67
Identity = 104/177 (58.76%), Postives = 129/177 (72.88%), Query Frame = 1
Query:    1 SREEEHPVKAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            S E EHPVKAFGWAARD++G LSPFKFSRR TG++DVRLKVL+CG+CH+D   I N WGF+ +P+VPGHEI G VTE                     +C SCESC ++ E++C   I TY SI  DGT+T+GGYSD MVA+E +I+R+P ++PLD+ APLLCAGIT YSPLKY+GL
Sbjct:    4 SSEIEHPVKAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGL 180          

HSP 2 Score: 54.299 bits (129), Expect = 5.773e-67
Identity = 27/52 (51.92%), Postives = 37/52 (71.15%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL 746
            + AKAFGA+VTVI  S S++ E LE LG DSFL   D EQ++GA ++  G++
Sbjct:  201 KMAKAFGAQVTVIDISESKRKEALEKLGADSFLLNSDQEQMKGARSSLDGII 252          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: CADH7_ARATH (Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 4.828e-66
Identity = 101/169 (59.76%), Postives = 121/169 (71.60%), Query Frame = 1
Query:   25 KAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            +AFG AA+D SG LSPF FSRR TG++DVR KVL+CGICHTDLS  KNEWG + +P+VPGHEI G VTE                     +C SC+SC +  ENYCPKMILT  + N D T+T+GGYSDHMV  E +I+R PD++PLD AAPLLCAG+TVYSP+KY GL
Sbjct:    8 EAFGLAAKDESGILSPFSFSRRATGEKDVRFKVLFCGICHTDLSMAKNEWGLTTYPLVPGHEIVGVVTEVGAKVKKFNAGDKVGVGYMAGSCRSCDSCNDGDENYCPKMILTSGAKNFDDTMTHGGYSDHMVCAEDFIIRIPDNLPLDGAAPLLCAGVTVYSPMKYHGL 176          

HSP 2 Score: 58.5362 bits (140), Expect = 4.828e-66
Identity = 40/104 (38.46%), Postives = 56/104 (53.85%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLL-TXXXXXXXXXXXXSIKFPGQLGSGCAPNTPPTYLEFPNM-GKKKGSGTPPG 896
            +FAKA G KVTVISTS  ++ E +  LG D+FL +RDP+Q++ AM T  G++ T             +K  G+L    AP  P     FP + G+K   G+  G
Sbjct:  197 KFAKAMGTKVTVISTSERKRDEAVTRLGADAFLVSRDPKQMKDAMGTMDGIIDTVSATHPLLPLLGLLKNKGKLVMVGAPAEPLELPVFPLIFGRKMVVGSMVG 300          
BLAST of DY259735 vs. ExPASy Swiss-Prot
Match: CADH3_ORYSJ (Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 2.373e-65
Identity = 98/169 (57.99%), Postives = 123/169 (72.78%), Query Frame = 1
Query:   25 KAFGWAARDSSGHLSPFKFSRRETGDEDVRLKVLYCGICHTDLSNIKNEWGFSLFPMVPGHEIAGEVTEXXXXXXXXXXXXXXXXXXXXXACHSCESCANDLENYCPKMILTYSSINTDGTITYGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL 531
            +A G AARDSSGHLSPF  SRR TGD+DV +K+L+CGICH+DL  IKNEW  S++P+VPGHEIAG VTE                     +C SCESC N  EN+CP+ + TY+S++ DGT+TYGGYS  +V +ER++V FP++MPLD  APLLCAGITVY+P+KY GL
Sbjct:   15 QAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCIKNEWKHSIYPLVPGHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHCPEGVFTYNSVDKDGTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKYHGL 183          

HSP 2 Score: 55.0694 bits (131), Expect = 2.373e-65
Identity = 34/102 (33.33%), Postives = 50/102 (49.02%), Query Frame = 3
Query:  591 QFAKAFGAKVTVISTSPSQKTEVLEHLGPDSFLKTRDPEQLQGAMATWMGLLTXXXXXXXXXXXXSIKFPGQLGSGCAPNTPPTYLEFPNMGKKKGSGTPPG 896
            +FA+AFG KVTVIS+SP +K E LE LG D+F+ +   E+++ A +T  G++             ++  P   G       P   LE P      G+ T  G
Sbjct:  204 KFARAFGLKVTVISSSPGKKREALERLGADAFVVSSSAEEMEAARSTMDGVINTVSANTPMAPYLALLKPN--GKMILVGLPENPLEVPPFSLVHGNRTLAG 303          
The following BLAST results are available for this feature:
BLAST of DY259735 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
MTDH_FRAAN8.310e-7563.43Probable mannitol dehydrogenase OS=Fragaria ananas... [more]
MTDH_MESCR2.013e-7362.86Probable mannitol dehydrogenase OS=Mesembryanthemu... [more]
MTDH_MEDSA1.838e-7157.54Probable mannitol dehydrogenase OS=Medicago sativa... [more]
GEDH1_OCIBA5.802e-7058.76Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GE... [more]
CADH6_ARATH8.254e-6959.89Probable cinnamyl alcohol dehydrogenase 6 OS=Arabi... [more]
CADH9_ARATH5.294e-6854.75Probable cinnamyl alcohol dehydrogenase 9 OS=Arabi... [more]
CADH8_ARATH1.174e-6759.76Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis th... [more]
MTDH_APIGR5.773e-6758.76Mannitol dehydrogenase OS=Apium graveolens GN=MTD ... [more]
CADH7_ARATH4.828e-6659.76Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis th... [more]
CADH3_ORYSJ2.373e-6557.99Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA13FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259735 ID=DY259735|Name=DY259735|organism=Citrus clementina|type=EST|length=1030bp
TCACGAGAAGAAGAACATCCAGTAAAGGCCTTTGGGTGGGCAGCCCGAGA
CAGCTCCGGCCATCTCTCCCCATTCAAATTCTCCAGAAGGGAAACGGGTG
ATGAGGATGTGAGGCTGAAGGTATTGTATTGTGGGATCTGCCATACTGAT
CTCTCCAACATCAAGAATGAATGGGGCTTCTCTCTCTTCCCTATGGTTCC
TGGGCATGAAATTGCAGGGGAAGTGACAGAAGTTGGTAGCAAAGTAAGAA
AGGTTAAAGTGGGAGATAAAGTTGGAGTTGGATGCATGGTCGGTGCATGC
CACAGCTGCGAGAGCTGTGCCAATGACCTTGAAAATTACTGTCCGAAAAT
GATACTCACCTACAGTTCCATTAACACTGACGGAACAATCACATACGGAG
GCTACTCTGATCACATGGTTGCCAATGAGCGCTACATTGTTCGATTCCCT
GATAGCATGCCCCTTGATGCTGCTGCCCCCCTGCTTTGCGCCGGGATTAC
CGTGTACAGTCCATTGAAATACTTTGGACTAGCAGAACAAGGAAAGCATG
TAGGCATCGTTGGCCTTGGCGGGCTTGGTCATGTCGCTGTCAATTTGCCA
AGGCTTTTGGGGCCAAAGTGACAGTAATTAGCACCTCTCCAAGCCAGAAG
ACTGAAGTTCTTGAACATCTTGGCCCTGATTCATTTTTGAAAACCCGTGA
CCCTGAACAATTGCAGGGTGCTATGGCCACTTGGATGGGATTATTGACAC
CGGGTCCCCCTGGGCCCCCATTTTGCCCTGGTCCGTCCATTAAATTCCCA
GGGCAGCTTGGTTCTGGTTGTGCCCCGAACACCCCCCCAACCTACCTTGA
ATTCCCTAATATGGGGAAAAAAAAGGGTTCGGGGACCCCCCCGGGGGAAA
AAAAAAACCCAAAAAAAATTAATTTCCCCAAAAACCAAAAAACCCCCAAA
CTTGGGGTTTTTTCAAGGTTTTTTCTAAACCCCAAGGGAAAGGTGGCCCC
GGGGGAAGGTCCCGACCATTTTTCCCTTAA
back to top