DY259739

Overview
NameDY259739
Unique NameDY259739
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259739 vs. ExPASy Swiss-Prot
Match: ILR3_ARATH (Transcription factor ILR3 OS=Arabidopsis thaliana GN=ILR3 PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 6.672e-68
Identity = 142/239 (59.41%), Postives = 162/239 (67.78%), Query Frame = 1
Query:   55 MVSPENTNWLLDYPLIDDITVPDGNFSVSASGFTWTVQPPINGPSNGCVEIDSAFGDSNGLXXXXXXXXXXXXXXXXXX-KACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAMST-QPSFL-TXXXXXXXXXXXXXXXXXNKLMPFITYPGIAMWQFMPPAAVETPQDHVLPPPVA 762
            MVSPEN NW+ D  LID      G+F++   GF+W VQ PI   SN    +D + G+S                      KACREK RRDRLNDKF+EL +ILEPG PPKTDKAAIL+DAVRMVTQLR EAQKLKDSNSSLQ+KIKELK EKNELRDEKQRLK EKEK+EQQLKAM+  QPSF                    NK++P I+YPG+AMWQFMPPA+V+T QDHVL PPVA
Sbjct:    1 MVSPENANWICD--LID---ADYGSFTIQGPGFSWPVQQPIGVSSNSSAGVDGSAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA 234          
BLAST of DY259739 vs. ExPASy Swiss-Prot
Match: BH115_ARATH (Transcription factor bHLH115 OS=Arabidopsis thaliana GN=BHLH115 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 5.471e-62
Identity = 135/237 (56.96%), Postives = 153/237 (64.56%), Query Frame = 1
Query:   55 MVSPENTNWLLDYPLIDDITVPDGNFSVSASGFTWTVQPPINGPSNGCVEIDSAFGDSNGLXXXXXXXXXXXXXXXXXX-KACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAMSTQPSFLTXXXXXXXXXXXXXXXXXNKLMPFITYPGIAMWQFMPPAAVETPQDHVLPPPVA 762
            MVSPENTNWL DYPLI+      G FS     F W     I+G +   VE+D    D++ +                   KACREK RRDRLNDKF EL+S+LEPGR PKTDK AI+ DA+RMV Q R EAQKLKD NSSLQEKIKELK EKNELRDEKQ+LK EKE+I+QQLKA+ TQP                     +KL+PF TYPG AMWQFMPPAAV+T QDHVL PPVA
Sbjct:    1 MVSPENTNWLSDYPLIE------GAFSDQNPTFPWQ----IDGSATVSVEVDGFLCDADVIKEPSSRKRIKTESCTGSNSKACREKQRRDRLNDKFTELSSVLEPGRTPKTDKVAIINDAIRMVNQARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKERIDQQLKAIKTQPQ-PQPCFLPNPQTLSQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA 226          
BLAST of DY259739 vs. ExPASy Swiss-Prot
Match: BH104_ARATH (Transcription factor bHLH104 OS=Arabidopsis thaliana GN=BHLH104 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 3.342e-35
Identity = 80/157 (50.96%), Postives = 107/157 (68.15%), Query Frame = 1
Query:  292 KACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAMSTQPSFLTXXXXXXXXXXXXXXXXXNKLMPFITYPGIAMWQFMPPAAVETPQDHVLPPPVA 762
            KACRE+LRR++LN++F++L+S+LEPGR PKTDK AIL DA+R++ QLR EA KL+++N  L E+IK LKAEKNELR+EK  LKA+KEK EQQLK+M T PS                    NK+  + +Y  + MW +MP +  +T +D  L PP A
Sbjct:  135 KACRERLRREKLNERFMDLSSVLEPGRTPKTDKPAILDDAIRILNQLRDEALKLEETNQKLLEEIKSLKAEKNELREEKLVLKADKEKTEQQLKSM-TAPS-------SGFIPHIPAAFNHNKMAVYPSYGYMPMWHYMPQSVRDTSRDQELRPPAA 283          
BLAST of DY259739 vs. ExPASy Swiss-Prot
Match: BH034_ARATH (Transcription factor bHLH34 OS=Arabidopsis thaliana GN=BHLH34 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 5.701e-35
Identity = 82/158 (51.90%), Postives = 105/158 (66.46%), Query Frame = 1
Query:  292 KACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAMST-QPSFLTXXXXXXXXXXXXXXXXXNKLMPFITYPGIAMWQFMPPAAVETPQDHVLPPPVA 762
            KACREKLRR++LNDKF++L+S+LEPGR PKTDK+AIL DA+R+V QLR EA +L+++N  L E+IK LKA+KNELR+EK  LKAEKEK+EQQLK+M    P F+                      P    P + MW  +PPA  +T +D    PPVA
Sbjct:  167 KACREKLRREKLNDKFMDLSSVLEPGRTPKTDKSAILDDAIRVVNQLRGEAHELQETNQKLLEEIKSLKADKNELREEKLVLKAEKEKMEQQLKSMVVPSPGFMPSQHPAAFHSHKMAVAYPYGYYP----PNMPMWSPLPPADRDTSRDLKNLPPVA 320          
BLAST of DY259739 vs. ExPASy Swiss-Prot
Match: BH121_ARATH (Transcription factor bHLH121 OS=Arabidopsis thaliana GN=BHLH121 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.848e-18
Identity = 49/101 (48.51%), Postives = 73/101 (72.28%), Query Frame = 1
Query:  292 KACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKI----EQQLKAMS 582
            KA REKLRR++LN+ FVEL ++L+P RP K DKA IL D V+++ +L SE  KLK   ++L ++ +EL  EKN+LR+EK  LK++ E +    +Q+L++MS
Sbjct:   63 KAGREKLRREKLNEHFVELGNVLDPERP-KNDKATILTDTVQLLKELTSEVNKLKSEYTALTDESRELTQEKNDLREEKTSLKSDIENLNLQYQQRLRSMS 162          
BLAST of DY259739 vs. ExPASy Swiss-Prot
Match: BH011_ARATH (Transcription factor bHLH11 OS=Arabidopsis thaliana GN=BHLH11 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.907e-14
Identity = 40/92 (43.48%), Postives = 65/92 (70.65%), Query Frame = 1
Query:  292 KACREKLRRDRLNDKFVELASILEPGRPPKTDKAAILIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQ 567
            KA REKLRRD+L ++F+EL + L+P RP K+DKA++L D ++M+  + ++  +LK    +L ++ +EL  EK+ELR+EK  LK++ E +  Q
Sbjct:   49 KAEREKLRRDKLKEQFLELGNALDPNRP-KSDKASVLTDTIQMLKDVMNQVDRLKAEYETLSQESRELIQEKSELREEKATLKSDIEILNAQ 139          
The following BLAST results are available for this feature:
BLAST of DY259739 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ILR3_ARATH6.672e-6859.41Transcription factor ILR3 OS=Arabidopsis thaliana ... [more]
BH115_ARATH5.471e-6256.96Transcription factor bHLH115 OS=Arabidopsis thalia... [more]
BH104_ARATH3.342e-3550.96Transcription factor bHLH104 OS=Arabidopsis thalia... [more]
BH034_ARATH5.701e-3551.90Transcription factor bHLH34 OS=Arabidopsis thalian... [more]
BH121_ARATH4.848e-1848.51Transcription factor bHLH121 OS=Arabidopsis thalia... [more]
BH011_ARATH1.907e-1443.48Transcription factor bHLH11 OS=Arabidopsis thalian... [more]
back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YA19FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259739 ID=DY259739|Name=DY259739|organism=Citrus clementina|type=EST|length=901bp
CAGGAAAATTTCTCTCCGCCGGAAAACCCATAAATATTATCCTGGAAATT
CAAAATGGTTTCTCCGGAAAATACGAATTGGCTATTAGATTACCCCTTGA
TCGACGATATCACTGTCCCTGATGGCAATTTCTCCGTTTCCGCTTCGGGT
TTCACTTGGACCGTTCAGCCGCCAATTAACGGGCCGTCAAATGGCTGTGT
GGAAATTGATTCTGCATTTGGGGATTCAAATGGTCTCAAGGAAAGCTCAA
AAAAGAGGGTTAGATCAGAATCATGTGGGTCTTCTAGCTCCAAGGCGTGC
AGGGAAAAGTTGCGTAGGGATCGTCTTAATGACAAGTTTGTGGAGTTAGC
CTCTATCTTAGAGCCTGGAAGGCCCCCCAAAACAGATAAGGCAGCTATTC
TGATTGATGCCGTCCGGATGGTGACTCAATTACGCAGTGAAGCCCAGAAG
TTGAAGGACTCAAATTCAAGTCTCCAGGAGAAGATCAAAGAGTTGAAGGC
TGAGAAGAATGAGCTTCGTGATGAGAAGCAGAGGCTAAAGGCAGAGAAAG
AGAAGATAGAGCAGCAACTCAAAGCTATGAGCACACAACCCAGTTTCTTA
ACTCCTCCTCCTGCAATCCCTGCTGCATTTGCTGCCCAAGGCCAAGCACC
TGGAAACAAGCTGATGCCTTTCATCACCTACCCTGGAATCGCAATGTGGC
AATTCATGCCTCCTGCTGCAGTGGAAACCCCACAGGATCATGTACTCCCT
CCTCCAGTTGCTTAAAGTAGCCACCCACAATGATTTTGGGTTTGCCATTT
GCCCCCACAAGGGAATTCGTTTATCATTGTTCCCCGAACGTAATAATTTT
TCCCAATCTTTAAAGATTGGGGGGGGGACAGGATATGAAACCCCCCAAGC
C
back to top