DY259745

Overview
NameDY259745
Unique NameDY259745
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1023
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 3.376e-58
Identity = 119/241 (49.38%), Postives = 143/241 (59.34%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYR--YCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CG G  C  +  G      +L  +ISR  F+ +L +RND  CPA+GFYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT  ETTGGW  AP G YAWGYC++R+  R  S YC      PC    QYYGRGPIQ++WN NY +CG A+G                SFKSA+WFWMTAQ   P SH    S  T  +           PGYG  TNII+GG+ECG+G +  V   IGF
Sbjct:   58 CGPG--CQSQCGGPSPAPTDLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRE--RNPSTYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADV---AARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGF 291          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 225.328 bits (573), Expect = 4.410e-58
Identity = 109/220 (49.55%), Postives = 135/220 (61.36%), Query Frame = 1
Query:  136 GELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYC--PCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G+L  IIS   F+D+L +RND  CPARGFYTY+AFI AAK+FP FG +G+   RK+E+AAFF QT  ETTGGW  AP G Y+WGYC+ +Q   PASDYC      PC    +YYGRGP+QL+WN NY  CG A+G                +FK+AIWFWMTAQP        ++               PGYG+ TNII+GG+ECG+G +  V   IGF
Sbjct:   84 GDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCF-KQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLVANDAVIAFKAAIWFWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGF 302          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.283e-57
Identity = 120/246 (48.78%), Postives = 144/246 (58.54%), Query Frame = 1
Query:   82 CGS-----GVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYR--YCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CGS     G  C  +  G      +L  +ISR  F+ +L +RND  CPA+GFYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT  ETTGGW  AP G YAWGYC++R+  R  S YC      PC    QYYGRGPIQ++WN NY +CG A+G                SFKSA+WFWMTAQ   P SH    S  T  +           PGYG  TNII+GG+ECG+G +  V   IGF
Sbjct:   50 CGSTTDYCGKDCQSQCGGPSPAPTDLSALISRSTFDQVLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRE--RNPSAYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADV---AARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGF 290          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.086e-56
Identity = 113/222 (50.90%), Postives = 139/222 (62.61%), Query Frame = 1
Query:  136 GELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYC--PCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG--FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G+L  IISR  F+D+L +RND  CPARGFYTYDAFI AAK+FP FG +G+   RK+EIAAFF QT  ETTGGW  AP G Y+WGYC+ +Q   P+S+YC      PC     YYGRGP+QL+WN NY +CG A+G                +FK+AIWFWMT  PQS + +      G  Q      A    PGYG+ TNII+GG+ECG+G +  V   IGF
Sbjct:   69 GDLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCF-KQEQNPSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQCGRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMT--PQSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDARVADRIGF 287          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 2.420e-56
Identity = 106/217 (48.85%), Postives = 136/217 (62.67%), Query Frame = 1
Query:  148 KIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCY---RYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            KIISR MF+ +L +RN+  CPA+GFYTYDAF+ AAK+FP+FG +G+  +RKRE+AAF  QT  ETTGGWP AP G YAWGYC++++   P+S+YC    RY PC     YYGRGP+QL+WN NY  CGEAL                 SFK+A+WFWMT Q         L+               PGYG+ TN+++GG+ECG+G N  V   +GF
Sbjct:    4 KIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKE-RNPSSNYCAPSPRY-PCAPGKSYYGRGPLQLSWNYNYGPCGEALRVNLLGNPDLVATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGF 218          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 3.160e-56
Identity = 112/220 (50.91%), Postives = 132/220 (60.00%), Query Frame = 1
Query:  103 GERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVS-RPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGG 759
            G  D G   D G L  II +  F+ LL +RND RCPA GFYTY+AFI AAK FP FGN+G++ MRKREIAAF  QT  ETTGGWPDAP G YAWGYCY+++++ +P  D    Y  C    QY GRGPIQL+WN NY  CG+ L                 SFK+AIWFWM  Q         ++ N             PGYG+ TNII+GGIECGQGG
Sbjct:   76 GGDDGGGDGDDGYLSDIIPKSKFDALLKFRNDARCPAAGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETTGGWPDAPCGPYAWGYCYLKEINCQPYCDPSSNY-QCVAGKQYCGRGPIQLSWNYNYGLCGDDLKLPLLQEPELVETDPVISFKTAIWFWMKPQSPKPSCHAVITGNWTPSAADLEAGRVPGYGVITNIINGGIECGQGG 294          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 5.390e-56
Identity = 109/239 (45.61%), Postives = 141/239 (59.00%), Query Frame = 1
Query:   82 CGSGV-VCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCY--RYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CG+    CG       +  G++G++I+R MF D+L +RN+  CP +GFYTYDAFI AAKAFP FG +G+ T RKREIAAF AQT  ETTGGW  AP G YAWGYCY+R+   P + YC      PC    +YYGRGPIQ+++N NY + G+A+G                SFK+A WFWMT Q         ++          +    PG+G+ TNII+GG+ECG+G    V   IGF
Sbjct:   44 CGNTADYCGSGCQSQCSSTGDIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAFLAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGA-YCVPSAQWPCAAGRKYYGRGPIQISYNYNYGQAGKAIGVDLVNNPDLVATDAVISFKTAFWFWMTPQSPKPSCHNVITGGWTPSGADRSAGRLPGFGVITNIINGGVECGKGVVPQVQDRIGF 281          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 5.390e-56
Identity = 119/238 (50.00%), Postives = 145/238 (60.92%), Query Frame = 1
Query:  100 CGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTG--GWPDAPGGEYAWGYCYIRQVSRPASDYCY--RYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRA-TKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            C  + +G G D G L  +I+RE F+ +L +RND  CPARGFYTYDAFI AAK+FPAF  +G++  RKRE+AAF AQT  ETTG  GW  AP G Y WGYCY R+++   +DYC      PC    QY+GRGP+QLTWN NY +CG A+G                SFKSA WFWMT Q   P  H     + S +G+ Q         PG+GL TNII+GG+ECGQG N  V   IGF
Sbjct:   58 CQSQCSGSGGDTGGLDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELN--PADYCQWDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAIGVDLLNNPDLLATDPTISFKSAFWFWMTPQSPKPSCHDVIIGAWSPSGSDQ----AAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGF 288          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 1.328e-54
Identity = 108/242 (44.63%), Postives = 139/242 (57.44%), Query Frame = 1
Query:   70 SAQNCGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYC--PCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            +++ CG G  C  + +G  + GG L  +IS + F ++L +RND  C  + FYTYDAF+ AAKAFP F N G+   +KREIAAF  QT  ETTGGWP AP G YAWGYC++R+  +  S YC      PC    QYYGRGPIQ++WN NY +CG A+G                SFK+A+WFWMT Q         ++               PGYG  TNII+GG+ECG+G +  V   IGF
Sbjct:   47 TSEYCGDG--CQSQCSG-SSGGGTLSSLISGDTFNNMLKHRNDNACQGKPFYTYDAFLSAAKAFPNFANKGDTATKKREIAAFLGQTSHETTGGWPTAPDGPYAWGYCFLRE--QNPSTYCQASSEFPCASGKQYYGRGPIQISWNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITGGWTPSSADRAAGRLPGYGTVTNIINGGLECGRGQDSRVQDRIGF 283          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.734e-54
Identity = 117/242 (48.35%), Postives = 145/242 (59.92%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTD--GGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG--FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CG G  C  +  G  T   GG+LG IIS  MF+ +L +RND  C  +GFY+Y+AFI AA++FP FG SG+ T RKREIAAFFAQT  ETTGGW  AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFKSA+WFWMT  PQS + +      G  Q      A    PG+G+ TNII+GG+ECG+G +  V   IGF
Sbjct:   54 CGPGN-CQSQCPGGPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSP-GDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMT--PQSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGF 291          
The following BLAST results are available for this feature:
BLAST of DY259745 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHIT_PHAVU3.376e-5849.38Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHIB_ARATH4.410e-5849.55Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI5_PHAVU1.283e-5748.78Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI2_BRANA1.086e-5650.90Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHIT_CARPA2.420e-5648.85Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI6_POPTR3.160e-5650.91Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHIB_VITVI5.390e-5645.61Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI1_THECC5.390e-5650.00Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHI2_PEA1.328e-5444.63Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHI2_TOBAC1.734e-5448.35Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB02FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259745 ID=DY259745|Name=DY259745|organism=Citrus clementina|type=EST|length=1023bp
GCTTTCAAAATGAGGCTCATTGGGTCCTTACTAATTTTCTCTCTAGTTTT
ATCTTTTGTACTAGGAGGTTCAGCACAGAATTGTGGAAGCGGCGTTGTGT
GCGGTGAACGTGATACTGGCCACGGGACGGATGGCGGTGAACTGGGCAAG
ATCATCTCAAGGGAGATGTTTGAAGACTTGCTTCCGTATAGAAATGATGT
ACGATGCCCTGCCAGAGGCTTCTACACTTACGATGCTTTTATAGAGGCAG
CCAAAGCTTTTCCAGCCTTTGGTAACTCTGGAAATGAAACCATGCGTAAA
AGAGAAATTGCTGCCTTTTTTGCCCAAACTGGCGATGAAACTACTGGGGG
ATGGCCCGATGCACCTGGTGGAGAATATGCTTGGGGATATTGCTATATTA
GGCAAGTTAGCCGCCCTGCGTCCGACTACTGTTATCGTTACTGTCCATGT
CCTTTGCCAGGGCAATACTATGGCCGAGGTCCAATTCAACTCACTTGGAA
TTGCAATTACTTAAGGTGCGGAGAAGCCTTGGGGGTGGACTTGTTGAACA
ATCCAGACCTTCTTGCCCCTGATCCAGTACTATCATTCAAGTCAGCAATC
TGGTTCTGGATGACTGCACAGCCCCAAAGCCATCGTGCCACGAAGTCATT
ATCGACGAATGGAAACCATCAGCAATTGAAGTAAACGCCCGCCGGCTTCC
CGGGATACGGTCTAACCACAAATATAATCCACGGTGGAATTGAATGTGGC
CAAGGTGGGAATGACCCTGTACCCACCCCTATTGGGTTCCTTACCCCTTT
TCGGTGGCAAGTTGGGGATTCGGCCCGGTGACCACCCTGATTGCCACACC
CACGGCCCTAAGGGCCTAACCGAAGGGCCCATTCCTAGTGATCCCCCTGA
TCCAGGTTTTAATAAATAAACCCTAATAAAAACCCACCTAAAAAAAACTT
TTAAATGGCCCAGTTGGTAGGGGGGCAACTAAATTTTTTCCTTTGGTTCC
CCCCTTATTGCAAGTAAAATAAA
back to top