DY262458

Overview
NameDY262458
Unique NameDY262458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1312
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12307 contig Ccv1_Contig12307:112..1425. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY262458 vs. ExPASy Swiss-Prot
Match: MGP_ARATH (Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 5.084e-60
Identity = 121/273 (44.32%), Postives = 162/273 (59.34%), Query Frame = 2
Query:  275 KRKRKPAGTPDPDAEVVSLSPKTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRETQEVRKRVFVCPEPSCLHHDPCHALGDLVGIKKHFRRKHSNHKQWVCDKCNKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQDACTMRRVQQPE-SQAMHAQXXXXXXXXXXXXXXXDANFSIPPALPGLPLQKPGEPVFLYSSRNNASISDHQQEH--------ILSF----SCYHHHRTPMQHELPMKLCTPFEAFNWVKG 1054
            K+KR   G PDP+AEV++LSPKTL+ ++R++CEIC +GFQRDQNLQ+HRR H +PWKL +R ++EVRKRV+VCPE SC+HH P  ALGDL GIKKHF RKH   K+W C+KC K YAVQSD+KAH KTCGTR + CDCG +FSR +SFI H+  C     +    + A H +                      P+LP  P    G P   +   +   I+ +  +H         LS     +  HH +  ++  +  +  +P E +NWV G
Sbjct:   41 KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKH-GEKKWKCEKCAKRYAVQSDWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDALAEETARLNAASHLKSFAATAGSNLNYHYLMGTLIPSPSLPQPPSFPFGPPQPQHHHHHQFPITTNNFDHQDVMKPASTLSLWSGGNINHHQQVTIEDRMAPQPHSPQEDYNWVFG 312          
BLAST of DY262458 vs. ExPASy Swiss-Prot
Match: JKD_ARATH (Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 4.028e-57
Identity = 98/156 (62.82%), Postives = 125/156 (80.13%), Query Frame = 2
Query:  275 KRKRKPAGTPDPDAEVVSLSPKTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRETQEV-RKRVFVCPEPSCLHHDPCHALGDLVGIKKHFRRKHSNHKQWVCDKCNKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQDAC 739
            K+KR   GTPDPDA+V++LSP TL+ ++R+VCEICN+GFQRDQNLQ+HRR H +PWKL +R  QEV +K+V++CP  +C+HHD   ALGDL GIKKH+ RKH   K+W C+KC+K YAVQSD+KAH KTCGTR + CDCG +FSR +SFI H+  C
Sbjct:   53 KKKRNQPGTPDPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSKQEVIKKKVYICPIKTCVHHDASRALGDLTGIKKHYSRKH-GEKKWKCEKCSKKYAVQSDWKAHAKTCGTREYKCDCGTLFSRKDSFITHRAFC 207          
BLAST of DY262458 vs. ExPASy Swiss-Prot
Match: NUC_ARATH (Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 6.871e-57
Identity = 97/155 (62.58%), Postives = 123/155 (79.35%), Query Frame = 2
Query:  275 KRKRKPAGTPDPDAEVVSLSPKTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRETQEVRKRVFVCPEPSCLHHDPCHALGDLVGIKKHFRRKHSNHKQWVCDKCNKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQDAC 739
            K+KR   G PDP+AEV++LSP TL+ ++R++CE+C +GFQRDQNLQ+HRR H +PWKL +R ++EVRKRV+VCPE +C+HH    ALGDL GIKKHF RKH   K+W C+KC K YAVQSD+KAH KTCGTR + CDCG +FSR +SFI H+  C
Sbjct:   37 KKKRNLPGNPDPEAEVIALSPTTLMATNRFLCEVCGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHSSRALGDLTGIKKHFCRKH-GEKKWTCEKCAKRYAVQSDWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFC 190          
BLAST of DY262458 vs. ExPASy Swiss-Prot
Match: STOP1_ARATH (Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.217e-14
Identity = 46/156 (29.49%), Postives = 72/156 (46.15%), Query Frame = 2
Query:  302 PDPDAEVVSLSPKTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRETQEVRKRV----------FVCPEPSC---LHHDPCHALGDLVGIKKHFRRKHSNHKQWVCDKCN-KGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEH 727
            P    E++ L  + +L    + C IC +GF+RD NL+MH R H   +K      +  ++ V          + CP   C     H     L  ++ +K H++R H + K + C +C+ K ++V +D K H K CG     C CG  FSR +    H
Sbjct:  224 PPGSYEILQLEKEEILAPHTHFCTICGKGFKRDANLRMHMRGHGDEYKTAAALAKPNKESVPGSEPMLIKRYSCPFLGCKRNKEHKKFQPLKTILCVKNHYKRTHCD-KSFTCSRCHTKKFSVIADLKTHEKHCGKNKWLCSCGTTFSRKDKLFGH 378          
The following BLAST results are available for this feature:
BLAST of DY262458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
MGP_ARATH5.084e-6044.32Zinc finger protein MAGPIE OS=Arabidopsis thaliana... [more]
JKD_ARATH4.028e-5762.82Zinc finger protein JACKDAW OS=Arabidopsis thalian... [more]
NUC_ARATH6.871e-5762.58Zinc finger protein NUTCRACKER OS=Arabidopsis thal... [more]
STOP1_ARATH4.217e-1429.49Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Ara... [more]
back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AB06RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262458 ID=DY262458|Name=DY262458|organism=Citrus clementina|type=EST|length=1312bp
AAAGAACTTAAAGTGAGAAAAGGAAAAAAAAAAAAAACGCTTTCTTCTTT
TCTTTCTCTTTTCCCCCCTTCCTCTCCACCCATTTTGTTCTTTTTATCAG
TAAAGCTGAAAAACAAAGGCCGCTATTCCTGCATCACCACCACTTTGTAG
TATCGCCTTGCTAGTCAACAAAAATTCTAACCCCATGTTAGAAAACAACA
TCAATATTATTGCTCCTTCTTCATCTTCTGATCCTTTCTCCTCTTCAGAA
AATGGTGCTCTCGCTATTCATAACAAAAGGAAAAGAAAACCAGCAGGCAC
CCCAGATCCGGATGCAGAGGTGGTTTCTTTATCACCCAAGACCTTGTTAG
AATCAGACAGATATGTTTGTGAGATCTGCAACCAAGGGTTTCAAAGAGAC
CAAAACCTGCAAATGCATAGAAGAAGGCACAAGGTGCCATGGAAGTTGCT
GAAGAGAGAAACACAAGAAGTGAGGAAGAGGGTTTTTGTTTGTCCAGAGC
CAAGCTGCTTGCACCATGACCCTTGTCATGCTTTGGGAGATCTTGTTGGT
ATCAAAAAGCACTTTAGAAGGAAGCACAGCAACCACAAGCAGTGGGTTTG
TGACAAGTGCAATAAAGGATATGCTGTTCAATCTGATTACAAAGCACATC
TCAAAACTTGTGGTACTAGAGGCCATTCTTGTGACTGTGGCCGAGTGTTT
TCCAGGGTTGAAAGTTTCATTGAACACCAAGATGCTTGCACTATGCGGCG
AGTCCAGCAGCCTGAATCGCAGGCAATGCATGCTCAGCCGGCTTGTTCAT
CAAGAACTGCTTCAAGTACAAGTCCATCGAGTGATGCCAATTTCAGCATA
CCACCAGCTTTGCCAGGACTGCCGTTGCAAAAGCCCGGAGAGCCCGTTTT
CTTGTACTCTAGTCGAAACAATGCTTCAATCTCTGATCATCAACAAGAAC
ACATCTTGAGCTTCAGCTGCTACCATCATCATCGAACTCCAATGCAACAC
GAACTTCCTATGAAACTATGCACCCCATTTGAAGCTTTCAATTGGGTCAA
GGGACAGTGGCGGCAAAAACAGGGATCAAATAAACCTCATCAGTTTGGGA
GCAACTGCCTGGCAAACCTTTCTTTGAAAGCAAAAAAATTAAAAAAAATT
TGCTAACAAACCAAACAAAAATTTACCCCGGGGTAAAAAAAAGGATAAAG
CTTAAAAAAAGGCTAAAAAAAAAAACCCCAAAAGAGCAAAAAAAAAAAAA
GGGGGCCAAAAAATATATTATTTTTTGCAAAATAGATCTTAAAAAGAAAG
TTAAAAGTGAAC
back to top