CMJ_chr3_010460.1
Transcript Overview
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of CMJ_chr3_010460.1 vs. ExPASy TrEMBL
Match: A0A067D394|A0A067D394_CITSI (CCHC-type domain-containing protein OS=Citrus sinensis OX=2711 GN=CISIN_1g037800mg PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 1.889e-18 Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 0 Query: 4 ETMGEKGLGGEKTTTVAAPGKDAGRDDQNEPKFRPWIVVSRKGKQHVNKGE 54 E ++GLGGEKTTT AAPGKDAGRDDQNEPKF PW+VVSRKGKQ VNKG+ Sbjct: 126 EACPDRGLGGEKTTTAAAPGKDAGRDDQNEPKFGPWMVVSRKGKQRVNKGK 176 HSP 2 Score: 71.633 bits (174), Expect = 2.177e-12 Identity = 34/38 (89.47%), Postives = 36/38 (94.74%), Query Frame = 0 Query: 53 GEPPNTGTFEVNENAEDDSNDNDFMHESGDGNSDSIEE 90 GEPPNTGTFEVNENAEDDSND+DFMHESGD NSDS E+ Sbjct: 344 GEPPNTGTFEVNENAEDDSNDSDFMHESGDRNSDSTED 381
BLAST of CMJ_chr3_010460.1 vs. ExPASy TrEMBL
Match: A0A2H5QWJ5|A0A2H5QWJ5_CITUN (CCHC-type domain-containing protein OS=Citrus unshiu OX=55188 GN=CUMW_268340 PE=4 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 2.716e-18 Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 0 Query: 4 ETMGEKGLGGEKTTTVAAPGKDAGRDDQNEPKFRPWIVVSRKGKQHVNKGE 54 E ++GLGGEKTTT AAPGKDAGRDDQNEPKF PW+VVSRKGKQ VNKG+ Sbjct: 270 EACPDRGLGGEKTTTAAAPGKDAGRDDQNEPKFGPWMVVSRKGKQRVNKGK 320 The following BLAST results are available for this feature:
BLAST of CMJ_chr3_010460.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt TrEMBL) Total hits: 2 Position : 0 Zoom : x 1
BLAST of CMJ_chr3_010460.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt Swissprot) Total hits: 0 Position : 0 Zoom : x 1
BLAST of CMJ_chr3_010460.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs Araport11) Total hits: 0 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterProScan Analysis for Citrus maxima Cupi Majiayou v1.0 proteins
Date Performed: 2023-05-12 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >CMJ_chr3_010460.1_cmj_v1 ID=CMJ_chr3_010460.1_cmj_v1; Name=CMJ_chr3_010460.1; organism=Citrus maxima; type=mRNA; length=282bpback to top protein sequence of CMJ_chr3_010460.1_cmj_v1 >CMJ_chr3_010460.1_cmj_v1 ID=CMJ_chr3_010460.1_cmj_v1; Name=CMJ_chr3_010460.1_cmj_v1; organism=Citrus maxima; type=polypeptide; length=94bpback to top mRNA from alignment at chr3:27042748..27043535+ Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.> ID=; Name=; organism= ; type=; length=788bp; location=Sequence derived from: chr3:27042748..27043535+ (Citrus maximaback to top Coding sequence (CDS) from alignment at chr3:27042748..27043535+ >CMJ_chr3_010460.1_cmj_v1 ID=CMJ_chr3_010460.1_cmj_v1; Name=CMJ_chr3_010460.1; organism=Citrus maxima; type=CDS; length=282bp; location=Sequence derived from: chr3:27042748..27043535+ (Citrus maximaback to top |