CMJ_chr3_010540.1
Transcript Overview
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of CMJ_chr3_010540.1 vs. ExPASy TrEMBL
Match: A0A2H5QGB2|A0A2H5QGB2_CITUN (14_3_3 domain-containing protein (Fragment) OS=Citrus unshiu OX=55188 GN=CUMW_224060 PE=3 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 3.087e-17 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0 Query: 58 QPALLEFCQVSSSCSVGSDLPYHAVANKSQLSSRSVGSDLPHTTIVSSPTTAAIILLR 115 +PALL+F QVSSS VGSDLP+HA A+KSQ SSRSVGSDLPH I SPT I+LLR Sbjct: 76 KPALLKFSQVSSSRCVGSDLPHHAAASKSQHSSRSVGSDLPHAAIALSPTAVVIVLLR 133 The following BLAST results are available for this feature:
BLAST of CMJ_chr3_010540.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt TrEMBL) Total hits: 1 Position : 0 Zoom : x 1
BLAST of CMJ_chr3_010540.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt Swissprot) Total hits: 0 Position : 0 Zoom : x 1
BLAST of CMJ_chr3_010540.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs Araport11) Total hits: 0 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >CMJ_chr3_010540.1_cmj_v1 ID=CMJ_chr3_010540.1_cmj_v1; Name=CMJ_chr3_010540.1; organism=Citrus maxima; type=mRNA; length=348bpback to top protein sequence of CMJ_chr3_010540.1_cmj_v1 >CMJ_chr3_010540.1_cmj_v1 ID=CMJ_chr3_010540.1_cmj_v1; Name=CMJ_chr3_010540.1_cmj_v1; organism=Citrus maxima; type=polypeptide; length=116bpback to top mRNA from alignment at chr3:27159867..27160602- Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.> ID=; Name=; organism= ; type=; length=736bp; location=Sequence derived from: chr3:27159867..27160602- (Citrus maximaback to top Coding sequence (CDS) from alignment at chr3:27159867..27160602- >CMJ_chr3_010540.1_cmj_v1 ID=CMJ_chr3_010540.1_cmj_v1; Name=CMJ_chr3_010540.1; organism=Citrus maxima; type=CDS; length=348bp; location=Sequence derived from: chr3:27159867..27160602- (Citrus maximaback to top |