CMJ_chr3_015330.1
Transcript Overview
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of CMJ_chr3_015330.1 vs. ExPASy TrEMBL
Match: A0A2H5QEW3|A0A2H5QEW3_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_223480 PE=4 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 4.754e-21 Identity = 43/49 (87.76%), Postives = 44/49 (89.80%), Query Frame = 0 Query: 58 MAWGRWWSASALRWPQYYFAVMSSPSTWITRELSFVDDVVWSVVTAVES 106 MAWGRWW ASALRWPQ+Y MS PSTWITRELSFVDDVVWSVVTAVES Sbjct: 1 MAWGRWWCASALRWPQHYLTAMSWPSTWITRELSFVDDVVWSVVTAVES 49
BLAST of CMJ_chr3_015330.1 vs. ExPASy TrEMBL
Match: V4V4F7|V4V4F7_CITCL (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10003072mg PE=4 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 4.754e-21 Identity = 43/49 (87.76%), Postives = 44/49 (89.80%), Query Frame = 0 Query: 58 MAWGRWWSASALRWPQYYFAVMSSPSTWITRELSFVDDVVWSVVTAVES 106 MAWGRWW ASALRWPQ+Y MS PSTWITRELSFVDDVVWSVVTAVES Sbjct: 1 MAWGRWWCASALRWPQHYLTAMSWPSTWITRELSFVDDVVWSVVTAVES 49
BLAST of CMJ_chr3_015330.1 vs. ExPASy TrEMBL
Match: A0A067GPJ2|A0A067GPJ2_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g035355mg PE=4 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 4.754e-21 Identity = 43/49 (87.76%), Postives = 44/49 (89.80%), Query Frame = 0 Query: 58 MAWGRWWSASALRWPQYYFAVMSSPSTWITRELSFVDDVVWSVVTAVES 106 MAWGRWW ASALRWPQ+Y MS PSTWITRELSFVDDVVWSVVTAVES Sbjct: 1 MAWGRWWCASALRWPQHYLTAMSWPSTWITRELSFVDDVVWSVVTAVES 49 The following BLAST results are available for this feature:
BLAST of CMJ_chr3_015330.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt TrEMBL) Total hits: 3 Position : 0 Zoom : x 1
BLAST of CMJ_chr3_015330.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt Swissprot) Total hits: 0 Position : 0 Zoom : x 1
BLAST of CMJ_chr3_015330.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs Araport11) Total hits: 0 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >CMJ_chr3_015330.1_cmj_v1 ID=CMJ_chr3_015330.1_cmj_v1; Name=CMJ_chr3_015330.1; organism=Citrus maxima; type=mRNA; length=348bpback to top protein sequence of CMJ_chr3_015330.1_cmj_v1 >CMJ_chr3_015330.1_cmj_v1 ID=CMJ_chr3_015330.1_cmj_v1; Name=CMJ_chr3_015330.1_cmj_v1; organism=Citrus maxima; type=polypeptide; length=116bpback to top mRNA from alignment at chr3:33921483..33922082- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.> ID=; Name=; organism= ; type=; length=600bp; location=Sequence derived from: chr3:33921483..33922082- (Citrus maximaback to top Coding sequence (CDS) from alignment at chr3:33921483..33922082- >CMJ_chr3_015330.1_cmj_v1 ID=CMJ_chr3_015330.1_cmj_v1; Name=CMJ_chr3_015330.1; organism=Citrus maxima; type=CDS; length=348bp; location=Sequence derived from: chr3:33921483..33922082- (Citrus maximaback to top |