CMJ_chr8_012810.1
Transcript Overview
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of CMJ_chr8_012810.1 vs. ExPASy TrEMBL
Match: V4SDU4|V4SDU4_CITCL (Uncharacterized protein (Fragment) OS=Citrus clementina OX=85681 GN=CICLE_v100279792mg PE=4 SV=1) HSP 1 Score: 124.405 bits (311), Expect = 1.606e-35 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0 Query: 20 GGNVGFGNVGNVGCCGIPGTEGRGGNVGNCNRLRAASPSLMEANAKATKKANMKQLLEAILGLC 83 GGNVGFGNVGNVGCCGIPGTEGRGGNVGNCNRLRAASPSLMEANA+ATKKANMKQLLEAILGLC Sbjct: 1 GGNVGFGNVGNVGCCGIPGTEGRGGNVGNCNRLRAASPSLMEANARATKKANMKQLLEAILGLC 64 The following BLAST results are available for this feature:
BLAST of CMJ_chr8_012810.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt TrEMBL) Total hits: 1 Position : 0 Zoom : x 1
BLAST of CMJ_chr8_012810.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt Swissprot) Total hits: 0 Position : 0 Zoom : x 1
BLAST of CMJ_chr8_012810.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs Araport11) Total hits: 0 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >CMJ_chr8_012810.1_cmj_v1 ID=CMJ_chr8_012810.1_cmj_v1; Name=CMJ_chr8_012810.1; organism=Citrus maxima; type=mRNA; length=252bpback to top protein sequence of CMJ_chr8_012810.1_cmj_v1 >CMJ_chr8_012810.1_cmj_v1 ID=CMJ_chr8_012810.1_cmj_v1; Name=CMJ_chr8_012810.1_cmj_v1; organism=Citrus maxima; type=polypeptide; length=84bpback to top mRNA from alignment at chr8:21188177..21188500+ Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.> ID=; Name=; organism= ; type=; length=324bp; location=Sequence derived from: chr8:21188177..21188500+ (Citrus maximaback to top Coding sequence (CDS) from alignment at chr8:21188177..21188500+ >CMJ_chr8_012810.1_cmj_v1 ID=CMJ_chr8_012810.1_cmj_v1; Name=CMJ_chr8_012810.1; organism=Citrus maxima; type=CDS; length=252bp; location=Sequence derived from: chr8:21188177..21188500+ (Citrus maximaback to top |