CMJ_chr8_015420.1
Transcript Overview
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of CMJ_chr8_015420.1 vs. ExPASy TrEMBL
Match: A0A2H5NV16|A0A2H5NV16_CITUN (EF-hand domain-containing protein OS=Citrus unshiu OX=55188 GN=CUMW_077600 PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 3.272e-10 Identity = 31/41 (75.61%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 66 TVGDGNGDLDHVM-AVVRRLWARPSSVPAVRVTVGDCCLWV 105 T DG GD+D AVVRRLWA PSSVP VRVTVGDCCLWV Sbjct: 78 TYDDGAGDVDRDFDAVVRRLWACPSSVPTVRVTVGDCCLWV 118 The following BLAST results are available for this feature:
BLAST of CMJ_chr8_015420.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt TrEMBL) Total hits: 1 Position : 0 Zoom : x 1
BLAST of CMJ_chr8_015420.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt Swissprot) Total hits: 0 Position : 0 Zoom : x 1
BLAST of CMJ_chr8_015420.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs Araport11) Total hits: 0 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >CMJ_chr8_015420.1_cmj_v1 ID=CMJ_chr8_015420.1_cmj_v1; Name=CMJ_chr8_015420.1; organism=Citrus maxima; type=mRNA; length=318bpback to top protein sequence of CMJ_chr8_015420.1_cmj_v1 >CMJ_chr8_015420.1_cmj_v1 ID=CMJ_chr8_015420.1_cmj_v1; Name=CMJ_chr8_015420.1_cmj_v1; organism=Citrus maxima; type=polypeptide; length=106bpback to top mRNA from alignment at chr8:27870245..27870929+ Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.> ID=; Name=; organism= ; type=; length=685bp; location=Sequence derived from: chr8:27870245..27870929+ (Citrus maximaback to top Coding sequence (CDS) from alignment at chr8:27870245..27870929+ >CMJ_chr8_015420.1_cmj_v1 ID=CMJ_chr8_015420.1_cmj_v1; Name=CMJ_chr8_015420.1; organism=Citrus maxima; type=CDS; length=318bp; location=Sequence derived from: chr8:27870245..27870929+ (Citrus maximaback to top |