CMJ_chr8_018720.1
Transcript Overview
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Homology
BLAST of CMJ_chr8_018720.1 vs. ExPASy TrEMBL
Match: A0A067DMZ9|A0A067DMZ9_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g038177mg PE=4 SV=1) HSP 1 Score: 126.331 bits (316), Expect = 2.760e-32 Identity = 68/85 (80.00%), Postives = 75/85 (88.24%), Query Frame = 0 Query: 16 MCAPESSRQASKRKRKESSSSRFESSDAPITKTHLTNEDLNDVTSENPYQSCNEENLTKKKRGPTVCHNVANEDGDAIKKYTLQM 100 MCAPESSRQASKRKRKES SS+ ES DAPI +THLTNEDLNDVTSEN +QSCNEENLTKKKRGPT+CH+VANEDG KK L++ Sbjct: 1 MCAPESSRQASKRKRKESLSSKSESRDAPIIETHLTNEDLNDVTSENSHQSCNEENLTKKKRGPTICHDVANEDG---KKIVLEL 82 The following BLAST results are available for this feature:
BLAST of CMJ_chr8_018720.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt TrEMBL) Total hits: 1 Position : 0 Zoom : x 1
BLAST of CMJ_chr8_018720.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs UniProt Swissprot) Total hits: 0 Position : 0 Zoom : x 1
BLAST of CMJ_chr8_018720.1 vs. ExPASy TrEMBL
Analysis Date: 2023-05-15 (Blastp of Citrus maxima Cupi Majiayou v1.0 proteins vs Araport11) Total hits: 0 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterProScan Analysis for Citrus maxima Cupi Majiayou v1.0 proteins
Date Performed: 2023-05-12 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >CMJ_chr8_018720.1_cmj_v1 ID=CMJ_chr8_018720.1_cmj_v1; Name=CMJ_chr8_018720.1; organism=Citrus maxima; type=mRNA; length=315bpback to top protein sequence of CMJ_chr8_018720.1_cmj_v1 >CMJ_chr8_018720.1_cmj_v1 ID=CMJ_chr8_018720.1_cmj_v1; Name=CMJ_chr8_018720.1_cmj_v1; organism=Citrus maxima; type=polypeptide; length=105bpback to top mRNA from alignment at chr8:30811373..30812931- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.> ID=; Name=; organism= ; type=; length=1559bp; location=Sequence derived from: chr8:30811373..30812931- (Citrus maximaback to top Coding sequence (CDS) from alignment at chr8:30811373..30812931- >CMJ_chr8_018720.1_cmj_v1 ID=CMJ_chr8_018720.1_cmj_v1; Name=CMJ_chr8_018720.1; organism=Citrus maxima; type=CDS; length=315bp; location=Sequence derived from: chr8:30811373..30812931- (Citrus maximaback to top |