FC931309

Overview
NameFC931309
Unique NameFC931309
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDH_SPHYA (Isocitrate dehydrogenase [NADP] OS=Sphingomonas yanoikuyae GN=icd PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.773e-56
Identity = 93/141 (65.96%), Postives = 121/141 (85.82%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATD 701
            ++KV+NP+VE+DGDEMTRIIW+ I+++LI PYLD+D+KYYDL +  RD T D++T+++A A  +Y V +KCATITPDE R++EFGLK MW+SPNGTIRNIL G VFREPI+ +N+PR+VPGW  PI +GRHAFGDQY+ATD
Sbjct:    3 KIKVKNPVVEIDGDEMTRIIWEWIRERLILPYLDVDLKYYDLSVEKRDETSDQITIDAANAIKEYGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGVVFREPIVIKNVPRLVPGWTDPIVVGRHAFGDQYKATD 143          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_PONAB (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Pongo abelii GN=IDH1 PE=2 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 2.315e-56
Identity = 100/137 (72.99%), Postives = 120/137 (87.59%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLIFPY++LD+  YDLGI NRDAT+D+VT ++AEA  KYNV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_BOVIN (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Bos taurus GN=IDH1 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.315e-56
Identity = 100/137 (72.99%), Postives = 120/137 (87.59%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLIFPY++LD+  YDLGI NRDAT+D+VT ++AEA  KYNV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_SHEEP (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Ovis aries GN=IDH1 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.949e-56
Identity = 100/137 (72.99%), Postives = 119/137 (86.86%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLIFPY+DLD+  YDL I NRDAT+D+VT ++AEA  KYNV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLIFPYVDLDLHSYDLSIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_HUMAN (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens GN=IDH1 PE=1 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 8.798e-56
Identity = 99/137 (72.26%), Postives = 120/137 (87.59%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLIFPY++LD+  YDLGI NRDAT+D+VT ++AEA  K+NV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_RAT (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rattus norvegicus GN=Idh1 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.149e-55
Identity = 99/137 (72.26%), Postives = 119/137 (86.86%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLI PY++LD+  YDLGI NRDAT+D+VT ++AEA  KYNV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_MOUSE (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mus musculus GN=Idh1 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.149e-55
Identity = 99/137 (72.26%), Postives = 119/137 (86.86%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLI PY++LD+  YDLGI NRDAT+D+VT ++AEA  KYNV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_MICOH (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Microtus ochrogaster GN=IDH1 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.149e-55
Identity = 99/137 (72.26%), Postives = 119/137 (86.86%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLI PY++LD+  YDLGI NRDAT+D+VT ++AEA  KYNV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_MICME (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Microtus mexicanus GN=IDH1 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.149e-55
Identity = 99/137 (72.26%), Postives = 119/137 (86.86%), Query Frame = 3
Query:  300 IVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +VEM GDEMTRIIW++IK+KLI PY++LD+  YDLGI NRDAT+D+VT ++AEA  KYNV +KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFRE I+C+NIPR+V GW KPI IGRHA+GDQYRATD V+
Sbjct:   10 VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_DICDI (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Dictyostelium discoideum GN=idhC PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 7.708e-52
Identity = 91/147 (61.90%), Postives = 117/147 (79.59%), Query Frame = 3
Query:  273 IDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVIK 713
            ++++ V NP+  + GDE TR+IW +I+ KLIFP+LDL ++ YDLGI  RD T+D+VT+++A A  +  V IKCATITPDE R+ EFGLK MW+SPNGTIRN L GT+FREPI+C+N+PR+V  W K I IGRHAFGDQYRATD V+K
Sbjct:    2 VEKIIVSNPVANLLGDEQTRVIWDLIEKKLIFPFLDLKVETYDLGIEYRDKTNDQVTIDAANAIKRLKVGIKCATITPDEARVTEFGLKEMWKSPNGTIRNTLGGTLFREPIVCKNVPRLVTCWNKSIVIGRHAFGDQYRATDFVVK 148          
The following BLAST results are available for this feature:
BLAST of FC931309 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
IDH_SPHYA1.773e-5665.96Isocitrate dehydrogenase [NADP] OS=Sphingomonas ya... [more]
IDHC_PONAB2.315e-5672.99Isocitrate dehydrogenase [NADP] cytoplasmic OS=Pon... [more]
IDHC_BOVIN2.315e-5672.99Isocitrate dehydrogenase [NADP] cytoplasmic OS=Bos... [more]
IDHC_SHEEP3.949e-5672.99Isocitrate dehydrogenase [NADP] cytoplasmic OS=Ovi... [more]
IDHC_HUMAN8.798e-5672.26Isocitrate dehydrogenase [NADP] cytoplasmic OS=Hom... [more]
IDHC_RAT1.149e-5572.26Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rat... [more]
IDHC_MOUSE1.149e-5572.26Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mus... [more]
IDHC_MICOH1.149e-5572.26Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mic... [more]
IDHC_MICME1.149e-5572.26Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mic... [more]
IDHC_DICDI7.708e-5261.90Isocitrate dehydrogenase [NADP] cytoplasmic OS=Dic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G04EF PostHarvP1 Citrus clementina cDNA clone C34103G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931309 ID=FC931309|Name=FC931309|organism=Citrus clementina|type=EST|length=715bp
GACGGCGTCTTAATTTAAACGCCTATTATCATTCCCAAATGCTCAGGCTC
ATCAATAGTAGTTGTGGCAGTTTACGATCAAGCGTCATGTCATCTGCTGC
TGCCACCACCAAAATGATGTCATCGTCAACCGTCGCCGTTAAAAACCCCA
GATGGTCACTCTCTTCTTCAAACAATTCCGGTTTATTCAGCGGATATGTG
AACAATCGTGTGTCGTTTCGGAACCAGCTGGCTCCTGCGATGTCGTTTCG
GTGTTTTGCTAGTGCCACGGGGATTGATAGAGTCAAGGTTCAGAATCCTA
TCGTTGAAATGGACGGCGATGAGATGACGAGGATTATTTGGCAGATGATA
AAAGACAAACTCATTTTTCCTTACTTAGATTTGGATATAAAGTATTATGA
CTTGGGGATATTGAATCGTGATGCAACTGATGACAAGGTTACCGTAGAAA
GCGCTGAAGCAACTCTAAAGTACAATGTTGCCATCAAATGTGCCACAATA
ACTCCTGATGAGACCAGAATGAAGGAGTTTGGGCTGAAGTCAATGTGGAG
AAGTCCCAATGGCACAATTAGAAACATTTTAAATGGTACTGTTTTCCGTG
AACCCATCCTATGCCAGAATATTCCTAGAATAGTTCCTGGTTGGAAGAAA
CCTATATGTATTGGTAGGCATGCCTTTGGTGATCAGTATCGTGCTACTGA
TACAGTCATTAAGGG
back to top