BQ623185
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_XENLA (Transcription elongation factor SPT4 OS=Xenopus laevis GN=supt4h1 PE=3 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 4.079e-14 Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 347 V DCT+ +F+GI+++M P SW ++W RI F PG Y ++V+ LP+ + + V Y Sbjct: 49 VYDCTSSSFDGIVAMMSPDDSWVSKWQRITNFKPGVYAVSVTGRLPQGIVRELKSRGVVY 108 HSP 2 Score: 41.5874 bits (96), Expect = 4.079e-14 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT42_MOUSE (Transcription elongation factor SPT4 2 OS=Mus musculus GN=Supt4h2 PE=2 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 1.163e-13 Identity = 22/60 (36.67%), Postives = 36/60 (60.00%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 347 V DCT+ +F+GI ++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 49 VYDCTSSSFDGINAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108 HSP 2 Score: 41.5874 bits (96), Expect = 1.163e-13 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4_ASPFU (Transcription elongation factor spt4 OS=Aspergillus fumigatus GN=spt4 PE=3 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 1.481e-13 Identity = 25/62 (40.32%), Postives = 41/62 (66.13%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVP 353 + +CT+ F G+I++ DP+ SW ARW R+ +V G Y + V+ +LP+D+ ED V+Y+P Sbjct: 51 IQECTSQVFEGLITLRDPSTSWVARWQRLEGYVAGTYAVKVTGSLPDDVITNLEDSGVRYIP 112 HSP 2 Score: 33.4982 bits (75), Expect = 1.481e-13 Identity = 12/25 (48.00%), Postives = 17/25 (68.00%), Query Frame = 2 Query: 59 SLRACLRCRLVKTYDQFRESGCENC 133 +LRAC+ C LV+ + +F GC NC Sbjct: 14 TLRACMVCSLVQLHSKFMRDGCPNC 38
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_CAEEL (Transcription elongation factor SPT4 OS=Caenorhabditis elegans GN=spt-4 PE=2 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 3.306e-13 Identity = 23/66 (34.85%), Postives = 40/66 (60.61%), Query Frame = 3 Query: 165 RVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR 362 +V DCT+ N++G+I+ M SW +W ++ R V G Y ++VS LP ++ + + V+Y P +R Sbjct: 47 KVYDCTSANYDGMIAAMSNNESWVCKWQKMQRKVKGMYAISVSGVLPNNIVSELKSLGVRYKPNQR 112 HSP 2 Score: 39.6614 bits (91), Expect = 3.306e-13 Identity = 15/25 (60.00%), Postives = 20/25 (80.00%), Query Frame = 2 Query: 59 SLRACLRCRLVKTYDQFRESGCENC 133 +LRACL C LVK+ + F++ GCENC Sbjct: 11 NLRACLLCSLVKSVESFQKEGCENC 35
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_CAEBR (Transcription elongation factor SPT4 OS=Caenorhabditis briggsae GN=spt-4 PE=3 SV=1) HSP 1 Score: 50.0618 bits (118), Expect = 5.876e-12 Identity = 22/66 (33.33%), Postives = 40/66 (60.61%), Query Frame = 3 Query: 165 RVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR 362 +V DCT+ N++G+I+ M SW +W ++ R V G Y ++VS +LP ++ + + V+Y +R Sbjct: 47 KVYDCTSANYDGMIAAMSNDDSWVCKWQKMQRRVKGIYAISVSGSLPSNVVSDLKSMGVRYKANQR 112 HSP 2 Score: 39.6614 bits (91), Expect = 5.876e-12 Identity = 15/25 (60.00%), Postives = 19/25 (76.00%), Query Frame = 2 Query: 59 SLRACLRCRLVKTYDQFRESGCENC 133 +LRACL C L+K+ D F+ GCENC Sbjct: 11 NLRACLLCSLIKSVDAFQTDGCENC 35
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4_ASHGO (Transcription elongation factor SPT4 OS=Ashbya gossypii GN=SPT4 PE=3 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.853e-12 Identity = 19/51 (37.25%), Postives = 36/51 (70.59%), Query Frame = 3 Query: 171 VDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNL 323 ++CT+P+F G++ + PT+SW A+W+ + ++VPG Y + V LP ++ +L Sbjct: 39 IECTSPSFEGLVGMCKPTKSWVAKWISVEQYVPGMYAIKVDGRLPVEVVDL 89 HSP 2 Score: 32.3426 bits (72), Expect = 7.853e-12 Identity = 11/23 (47.83%), Postives = 16/23 (69.57%), Query Frame = 2 Query: 65 RACLRCRLVKTYDQFRESGCENC 133 RAC+ C +V+T ++F GC NC Sbjct: 5 RACMLCGIVQTTNEFTRDGCPNC 27
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4_KLULA (Transcription elongation factor SPT4 OS=Kluyveromyces lactis GN=SPT4 PE=3 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 2.235e-11 Identity = 20/51 (39.22%), Postives = 34/51 (66.67%), Query Frame = 3 Query: 171 VDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNL 323 V+CT+P+F G++ + P+RSW ARW+ I ++PG Y + + LP ++ L Sbjct: 39 VECTSPSFEGLVGMCKPSRSWVARWMSIDSYIPGMYAVKIDGRLPIEVTEL 89 HSP 2 Score: 31.187 bits (69), Expect = 2.235e-11 Identity = 11/23 (47.83%), Postives = 16/23 (69.57%), Query Frame = 2 Query: 65 RACLRCRLVKTYDQFRESGCENC 133 RAC+ C LV++ +F +GC NC Sbjct: 5 RACMLCGLVQSTAEFNRNGCPNC 27
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4_GIBZE (Transcription elongation factor SPT4 OS=Gibberella zeae GN=SPT4 PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 3.825e-11 Identity = 27/64 (42.19%), Postives = 46/64 (71.88%), Query Frame = 3 Query: 165 RVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDE-RVQYVP 353 ++ CT+ F G+I++ +PT+SW A++ R+ +VPG Y + VS LP+D+++ EDE R+QY+P Sbjct: 26 QIESCTSQVFEGVITLANPTKSWIAKYQRLDSYVPGMYAIKVSGQLPDDVRSTLEDEYRIQYIP 89 HSP 2 Score: 21.1718 bits (43), Expect = 3.825e-11 Identity = 9/24 (37.50%), Postives = 12/24 (50.00%), Query Frame = 2 Query: 95 TYDQFRESGCENCPFFKMDEDHEP 166 T +F+ GC NC F + H P Sbjct: 2 TSQRFQNEGCPNCEEF-LHLQHSP 24 The following BLAST results are available for this feature:
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623185 ID=BQ623185; Name=BQ623185; organism=Citrus sinensis; type=EST; length=603bpback to top |