BQ623185
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT41_ARATH (Transcription elongation factor SPT4 homolog 1 OS=Arabidopsis thaliana GN=At5g08565 PE=3 SV=3) HSP 1 Score: 120.553 bits (301), Expect = 1.368e-47 Identity = 53/66 (80.30%), Postives = 60/66 (90.91%), Query Frame = 3 Query: 165 RVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR 362 R+VD TTPNFNGIIS+MDP RSWAARWLRIG+F PGCYTLAVSEALPE++Q +C+ RVQYVPPKR Sbjct: 50 RIVDVTTPNFNGIISMMDPRRSWAARWLRIGKFAPGCYTLAVSEALPEEMQFICQQARVQYVPPKR 115 HSP 2 Score: 75.8702 bits (185), Expect = 1.368e-47 Identity = 31/37 (83.78%), Postives = 35/37 (94.59%), Query Frame = 2 Query: 53 GMSLRACLRCRLVKTYDQFRESGCENCPFFKMDEDHE 163 G LRACLRCRLVKTYDQFR+SGCENCPFFK+++DHE Sbjct: 13 GHELRACLRCRLVKTYDQFRDSGCENCPFFKIEDDHE 49 HSP 3 Score: 33.8834 bits (76), Expect = 1.368e-47 Identity = 14/15 (93.33%), Postives = 14/15 (93.33%), Query Frame = 1 Query: 16 MGSAPAQIPTSFGHE 60 MG APAQIPTSFGHE Sbjct: 1 MGEAPAQIPTSFGHE 15
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT42_ARATH (Transcription elongation factor SPT4 homolog 2 OS=Arabidopsis thaliana GN=At5g63670 PE=2 SV=1) HSP 1 Score: 120.939 bits (302), Expect = 1.004e-31 Identity = 57/84 (67.86%), Postives = 68/84 (80.95%), Query Frame = 3 Query: 117 RDA--RTVPSSRWMKTTSRVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR 362 RDA P + + R+V+ TTPNFNGIISVMDP+RSWAARWLRIG+F PGCYTLAVSE LPE++Q+LC++ERVQYV PKR Sbjct: 32 RDAGCENCPFFKMEEDHERIVEVTTPNFNGIISVMDPSRSWAARWLRIGKFAPGCYTLAVSEPLPEEMQHLCQEERVQYVLPKR 115 HSP 2 Score: 35.4242 bits (80), Expect = 1.004e-31 Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 1 Query: 16 MGSAPAQIPTSFGHE 60 MGSAPAQIPTSFGHE Sbjct: 1 MGSAPAQIPTSFGHE 15 HSP 3 Score: 77.411 bits (189), Expect = 6.104e-14 Identity = 32/37 (86.49%), Postives = 35/37 (94.59%), Query Frame = 2 Query: 53 GMSLRACLRCRLVKTYDQFRESGCENCPFFKMDEDHE 163 G LRACLRCRLVKTYDQFR++GCENCPFFKM+EDHE Sbjct: 13 GHELRACLRCRLVKTYDQFRDAGCENCPFFKMEEDHE 49
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4_NEUCR (Transcription elongation factor spt-4 OS=Neurospora crassa GN=spt-4 PE=3 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 7.974e-16 Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 3 Query: 165 RVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVP 353 ++ CT+ F GII++ +P +SW A+W R+ +V G Y VS LP+D++ ED+ +QY+P Sbjct: 49 QIDSCTSQVFEGIITIANPQKSWVAKWQRLDGYVKGVYATKVSGQLPDDVRTTLEDDGIQYIP 111 HSP 2 Score: 38.891 bits (89), Expect = 7.974e-16 Identity = 15/27 (55.56%), Postives = 19/27 (70.37%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENCPFF 142 LRAC+ C +V TY +FR+ GC NC F Sbjct: 14 LRACMVCSIVMTYARFRDEGCPNCEDF 40
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_MACFA (Transcription elongation factor SPT4 OS=Macaca fascicularis GN=SUPT4H1 PE=3 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.859e-14 Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 347 V DCT+ +F+GII++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 49 VYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108 HSP 2 Score: 41.5874 bits (96), Expect = 1.859e-14 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_HUMAN (Transcription elongation factor SPT4 OS=Homo sapiens GN=SUPT4H1 PE=1 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.859e-14 Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 347 V DCT+ +F+GII++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 49 VYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108 HSP 2 Score: 41.5874 bits (96), Expect = 1.859e-14 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_BOVIN (Transcription elongation factor SPT4 OS=Bos taurus GN=SUPT4H1 PE=3 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.859e-14 Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 347 V DCT+ +F+GII++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 49 VYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108 HSP 2 Score: 41.5874 bits (96), Expect = 1.859e-14 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT41_MOUSE (Transcription elongation factor SPT4 1 OS=Mus musculus GN=Supt4h1 PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.859e-14 Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 347 V DCT+ +F+GII++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 49 VYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108 HSP 2 Score: 41.5874 bits (96), Expect = 1.859e-14 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_PONAB (Transcription elongation factor SPT4 OS=Pongo abelii GN=SUPT4H1 PE=3 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 2.415e-14 Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 347 V DCT+ +F+GII++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 49 VYDCTSSSFDGIIAMMSPGDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108 HSP 2 Score: 41.5874 bits (96), Expect = 2.415e-14 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_DROME (Transcription elongation factor SPT4 OS=Drosophila melanogaster GN=spt4 PE=1 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 2.415e-14 Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 3 Query: 144 RWMKTTSRVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPE 308 R V D T+ NF+GII++ PT SW A+W R+ RF G Y ++VS LP+ Sbjct: 41 RMKNNKDNVYDHTSNNFDGIIALTTPTDSWVAKWQRLSRFTRGIYAISVSGTLPQ 95 HSP 2 Score: 43.5134 bits (101), Expect = 2.415e-14 Identity = 18/27 (66.67%), Postives = 20/27 (74.07%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENCPFF 142 LRACL C LVK++DQF GCENC F Sbjct: 13 LRACLVCSLVKSFDQFETDGCENCEEF 39
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Match: SPT4H_DANRE (Transcription elongation factor SPT4 OS=Danio rerio GN=supt4h1 PE=3 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 3.139e-14 Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 3 Query: 168 VVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALP 305 V +CT+ +F+G+I++M P SW A+W RIG F PG Y + V+ LP Sbjct: 49 VYECTSSSFDGVIAMMSPEDSWVAKWQRIGNFKPGVYAVTVTGRLP 94 HSP 2 Score: 41.5874 bits (96), Expect = 3.139e-14 Identity = 17/24 (70.83%), Postives = 18/24 (75.00%), Query Frame = 2 Query: 62 LRACLRCRLVKTYDQFRESGCENC 133 LRACL C LVKT DQF GC+NC Sbjct: 13 LRACLLCSLVKTIDQFEYDGCDNC 36 The following BLAST results are available for this feature:
BLAST of BQ623185 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623185 ID=BQ623185; Name=BQ623185; organism=Citrus sinensis; type=EST; length=603bpback to top |