CF504349
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF504349 vs. ExPASy Swiss-Prot
Match: PUB30_ARATH (U-box domain-containing protein 30 OS=Arabidopsis thaliana GN=PUB30 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.252e-12 Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = 3 Query: 72 KKMVRQELYIAVPNLFRCPISLDVMKSPVSLCTGVTYDRSSIQHWLESGHDTCPATMQIL 251 KKM+++ +P++F CPISL+ M+ PV+LCTG TY+R +I W GH TCP TMQ L Sbjct: 53 KKMIKELDLQDIPSVFICPISLEPMQDPVTLCTGQTYERLNIHKWFNLGHLTCPTTMQEL 112
BLAST of CF504349 vs. ExPASy Swiss-Prot
Match: PUB16_ARATH (U-box domain-containing protein 16 OS=Arabidopsis thaliana GN=PUB16 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.528e-11 Identity = 28/49 (57.14%), Postives = 38/49 (77.55%), Query Frame = 3 Query: 105 VPNLFRCPISLDVMKSPVSLCTGVTYDRSSIQHWLESGHDTCPATMQIL 251 +P FRCPI+L++M+ PV + TG TYDR SI W++SGH+TCP T Q+L Sbjct: 274 IPADFRCPITLELMRDPVVVATGQTYDRESIDLWIQSGHNTCPKTGQVL 322
BLAST of CF504349 vs. ExPASy Swiss-Prot
Match: PUB26_ARATH (U-box domain-containing protein 26 OS=Arabidopsis thaliana GN=PUB26 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.404e-11 Identity = 30/55 (54.55%), Postives = 38/55 (69.09%), Query Frame = 3 Query: 90 ELYIAVPNLFRCPISLDVMKSPVSLCTGVTYDRSSIQHWLESGHDTCPATMQILS 254 +L I +P FRCPISLD+M PV++ TG TYDR+SI W+ G+ TCP T LS Sbjct: 9 DLGIQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTRVALS 63
BLAST of CF504349 vs. ExPASy Swiss-Prot
Match: PUB22_ARATH (U-box domain-containing protein 22 OS=Arabidopsis thaliana GN=PUB22 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.404e-11 Identity = 29/53 (54.72%), Postives = 40/53 (75.47%), Query Frame = 3 Query: 99 IAVPNLFRCPISLDVMKSPVSLCTGVTYDRSSIQHWLESG-HDTCPATMQILS 254 I +P+ F CPISLD+MK PV + TG+TYDR SI+ WL SG ++CP T Q+++ Sbjct: 5 IEIPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVIT 57
BLAST of CF504349 vs. ExPASy Swiss-Prot
Match: PUB13_ARATH (U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.446e-11 Identity = 26/51 (50.98%), Postives = 39/51 (76.47%), Query Frame = 3 Query: 105 VPNLFRCPISLDVMKSPVSLCTGVTYDRSSIQHWLESGHDTCPATMQILST 257 +P+ FRCPISL++M+ PV + +G TY+R+ I+ W+E GH TCP T Q L++ Sbjct: 256 IPDDFRCPISLEMMRDPVIVSSGQTYERTCIEKWIEGGHSTCPKTQQALTS 306
BLAST of CF504349 vs. ExPASy Swiss-Prot
Match: PUB25_ARATH (U-box domain-containing protein 25 OS=Arabidopsis thaliana GN=PUB25 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.905e-11 Identity = 30/56 (53.57%), Postives = 42/56 (75.00%), Query Frame = 3 Query: 90 ELYIAVPNLFRCPISLDVMKSPVSLCTGVTYDRSSIQHWLESGHD-TCPATMQILS 254 +L I +P FRCPISL++M+ PV++CTG TYDR+SI+ W+ G++ TCP T LS Sbjct: 9 DLGIQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLS 64 The following BLAST results are available for this feature:
BLAST of CF504349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 16
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504349 ID=CF504349; Name=CF504349; organism=Citrus sinensis; type=EST; length=264bpback to top |