CK934203

Overview
NameCK934203
Unique NameCK934203
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length227
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1260 contig Csv1_Contig1260:671..895. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.507e-29
Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG  G   P
Sbjct:   70 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP 116          

HSP 2 Score: 58.9214 bits (141), Expect = 1.507e-29
Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPE+L++NGVKFGEAVWFKAG+QIFS+G
Sbjct:  108 LGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDG 142          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.507e-29
Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG  G   P
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFP 115          

HSP 2 Score: 58.151 bits (139), Expect = 1.507e-29
Identity = 26/35 (74.29%), Postives = 29/35 (82.86%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G  FPE+L KNGVKFGEAVWFKAG+QIF+EG
Sbjct:  107 LGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEG 141          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.507e-29
Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG  G   P
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFP 115          

HSP 2 Score: 60.8474 bits (146), Expect = 1.507e-29
Identity = 29/35 (82.86%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPEILSKNGV FGEAVWFKAG+QIFSEG
Sbjct:  107 LGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEG 141          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.510e-29
Identity = 42/47 (89.36%), Postives = 42/47 (89.36%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  G   P
Sbjct:   49 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFP 95          

HSP 2 Score: 57.7658 bits (138), Expect = 1.510e-29
Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPE+L++NGVKFGEA WFKAG+QIFSEG
Sbjct:   87 LGALGCVFPELLARNGVKFGEASWFKAGSQIFSEG 121          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB25_SOLLC (Chlorophyll a-b binding protein 5, chloroplastic (Fragment) OS=Solanum lycopersicum GN=CAB5 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.511e-29
Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG  G   P
Sbjct:   41 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFP 87          

HSP 2 Score: 60.8474 bits (146), Expect = 1.511e-29
Identity = 29/35 (82.86%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPEILSKNGV FGEAVWFKAG+QIFSEG
Sbjct:   79 LGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEG 113          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 1.515e-29
Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG  G   P
Sbjct:   68 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFP 114          

HSP 2 Score: 59.6918 bits (143), Expect = 1.515e-29
Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPE+L+KNGVKFGEAVWFKAG+QIF EG
Sbjct:  106 LGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEG 140          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.961e-29
Identity = 40/47 (85.11%), Postives = 40/47 (85.11%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPE FAKNRELEVIH RWAMLG  G   P
Sbjct:   78 LTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFP 124          

HSP 2 Score: 61.2326 bits (147), Expect = 1.961e-29
Identity = 28/35 (80.00%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPE+L++NGVKFGEAVWFKAGAQIFSEG
Sbjct:  116 LGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEG 150          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.555e-29
Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG  G   P
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFP 115          

HSP 2 Score: 60.077 bits (144), Expect = 2.555e-29
Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPE+L++NGVKFGEAVWFKAG+QIFSEG
Sbjct:  107 LGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEG 141          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB22_HORVU (Chlorophyll a-b binding protein 2, chloroplastic OS=Hordeum vulgare GN=CAB2 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.327e-29
Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG  G   P
Sbjct:   68 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFP 114          

HSP 2 Score: 58.151 bits (139), Expect = 3.327e-29
Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPE+L++NGVKFGEAVWFK G+QIFSEG
Sbjct:  106 LGALGCVFPELLARNGVKFGEAVWFKKGSQIFSEG 140          
BLAST of CK934203 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.327e-29
Identity = 41/47 (87.23%), Postives = 41/47 (87.23%), Query Frame = 2
Query:    8 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGXXGGRLP 148
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG  G   P
Sbjct:   70 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFP 116          

HSP 2 Score: 58.5362 bits (140), Expect = 3.327e-29
Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  123 LXXXGGVFPEILSKNGVKFGEAVWFKAGAQIFSEG 227
            L   G VFPE+ ++NGVKFGEAVWFKAG+QIFSEG
Sbjct:  108 LGALGCVFPELFARNGVKFGEAVWFKAGSQIFSEG 142          
The following BLAST results are available for this feature:
BLAST of CK934203 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
CB21_ARATH1.507e-2987.23Chlorophyll a-b binding protein 165/180, chloropla... [more]
CB215_PEA1.507e-2987.23Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB26_PETSP1.507e-2985.11Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB21_SOYBN1.510e-2989.36Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB25_SOLLC1.511e-2985.11Chlorophyll a-b binding protein 5, chloroplastic (... [more]
CB21_SILPR1.515e-2987.23Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB2B_PINSY1.961e-2985.11Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB21_SINAL2.555e-2985.11Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB22_HORVU3.327e-2987.23Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB24_PETSP3.327e-2987.23Chlorophyll a-b binding protein 25, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004540_A11 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IF_A11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934203 ID=CK934203; Name=CK934203; organism=Citrus sinensis; type=EST; length=227bp
CATCATACTGACTGGTGAGTTCCCTGGTGACTATGGCTGGGATACCGCTG
GTTTATCAGCAGACCCCGAGACATTTGCTAAGAACCGTGAGCTAGAGGTG
ATCCACAGCAGATGGGCAATGCTTGGANNNNNGGGGGGGCGTCTTCCCTG
AAATCCTCTCCAAGAATGGAGTGAAGTTCGGCGAAGCAGTTTGGTTCAAG
GCTGGCGCTCAAATATTCTCTGAAGGT
back to top