DR405962

Overview
NameDR405962
Unique NameDR405962
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_NEIMB (UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B GN=galE PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.009e-39
Identity = 81/173 (46.82%), Postives = 119/173 (68.79%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEW 680
            K ILVTGG G+IGSHTV+ LL  G++ V++DNL N+S   + ++K + G +   + F++ D+RD+  L  +FA+ +  +VIHFAGL+AVGESV +P+ Y+DNN+ G++ L E MA  G  ++VFSSSATVYG P  VP TE+ P  +  +PYG +K  +E I  D+ ++D  W
Sbjct:    2 KKILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQE---IPFYQGDIRDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFSIVFSSSATVYGDPGKVPYTEDMPPGDTTSPYGASKSMVERILTDIQKADPRW 171          

HSP 2 Score: 22.7126 bits (47), Expect = 2.009e-39
Identity = 8/10 (80.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  685 IILLRYFNPV 714
            +ILLRYFNP+
Sbjct:  173 MILLRYFNPI 182          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_NEIMC (UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.009e-39
Identity = 81/173 (46.82%), Postives = 118/173 (68.21%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEF-PLEAMNPYGRTKLFIEEICRDVHRSDSEW 680
            K ILVTGG G+IGSHTV+ LL  G++ V++DNL N+S   + ++K + G +   + F++ D+RD+  L  +FA+ +  +VIHFAGL+AVGESV +P+ Y+DNN+ G++ L E MA  G   +VFSSSATVYG P  VP TE+  P +  +PYG +K  +E I  D+ ++D  W
Sbjct:    2 KKILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRLKTITGQE---IPFYQGDIRDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSGSLVLAEEMARAGVFKIVFSSSATVYGDPGKVPYTEDMQPGDTTSPYGTSKSMVERILSDIQKADPRW 171          

HSP 2 Score: 23.483 bits (49), Expect = 2.009e-39
Identity = 8/10 (80.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  685 IILLRYFNPV 714
            +ILLRYFNP+
Sbjct:  173 VILLRYFNPI 182          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_YEREN (UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.443e-39
Identity = 82/164 (50.00%), Postives = 118/164 (71.95%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRD 656
            +IL+TGGAGYIGSHTVL LL  G   VV+DNL N+S  ++A+V ++ G + +   F+  D+ D++ L+ +F+  K  +VIHFAGL++VGESV+KP+ Y+ NN++G+ITLLE M     K L+FSSSATVYG P+ VP TE+  +    NPYG +K+ +E+I +D
Sbjct:    2 SILITGGAGYIGSHTVLTLLEQGRNVVVLDNLINSSAESLARVSKICGRKPN---FYHGDILDRSCLKLIFSSHKIDSVIHFAGLKSVGESVEKPIEYYQNNVVGSITLLEEMCLANVKKLIFSSSATVYGEPEFVPLTEKARIGGTTNPYGTSKVMVEQILKD 162          

HSP 2 Score: 23.483 bits (49), Expect = 4.443e-39
Identity = 10/15 (66.67%), Postives = 10/15 (66.67%), Query Frame = 1
Query:  685 IILLRYFNPVXXXPS 729
            I  LRYFNPV   PS
Sbjct:  172 ITALRYFNPVGAHPS 186          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_ERWAM (UDP-glucose 4-epimerase OS=Erwinia amylovora GN=galE PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.668e-38
Identity = 85/173 (49.13%), Postives = 116/173 (67.05%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWK 683
            +ILVTGGAGYIGSHTVL LL  G   V++DNL NAS  ++ +V++L G      TF + DL D++ L ++F+  +  AVIHFAGL+AVG S +KPL Y+ NN+ GT+ LLE M + G    +FSSSATVYG    VP  E  P+    +PYG +KL +E+I RD  +++ E+K
Sbjct:    2 SILVTGGAGYIGSHTVLSLLQRGDDVVILDNLSNASRESINRVEKLTGKTA---TFFEGDLLDRSCLRSVFSAHRISAVIHFAGLKAVGASTRKPLEYYQNNVTGTLVLLEEMRSAGVNQFIFSSSATVYGADAPVPYVETTPIGGTTSPYGTSKLMVEQILRDYAKANPEFK 171          

HSP 2 Score: 22.3274 bits (46), Expect = 1.668e-38
Identity = 9/11 (81.82%), Postives = 9/11 (81.82%), Query Frame = 1
Query:  682 KIILLRYFNPV 714
            K I LRYFNPV
Sbjct:  171 KTIALRYFNPV 181          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_DROME (Probable UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=CG12030 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.735e-38
Identity = 84/177 (47.46%), Postives = 116/177 (65.54%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEI------AVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEW 680
            +LVTGGAGYIGSHTVL++L  GY  + VDNL NA         A+++V+E+ G +   + F+++D+ D+  + ++F + K   V HFA L+AVGES + PL Y+ NN+ GT  LLE MA +     V+SSSATVYG PK +P TEE P     +PYG+TK F EEI +D+ +SD  W
Sbjct:    6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKK---VNFYRVDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYSSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRW 179          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_SALTI (UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 4.804e-38
Identity = 80/179 (44.69%), Postives = 113/179 (63.13%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            +LVTGG+GYIGSHT +QLL  G+  V++DNL N+    +  ++ L G    + TF + D+R++A +  +        VIHFAGL+AVGESV KPL Y+DNN+ GT+ L+  M A   KNL+FSSSATVYG    +P  E FP     +PYG++KL +E+I  D+ ++  EW   +   F
Sbjct:    3 VLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGK---HPTFVEGDIRNEALITEILHDHAIDTVIHFAGLKAVGESVAKPLEYYDNNVNGTLRLVSAMRAANVKNLIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPEWSIALLRYF 178          

HSP 2 Score: 25.409 bits (54), Expect = 4.804e-38
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  685 IILLRYFNPVXXXPS 729
            I LLRYFNPV   PS
Sbjct:  172 IALLRYFNPVGAHPS 186          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_ECOLI (UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 6.258e-38
Identity = 78/179 (43.58%), Postives = 113/179 (63.13%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            +LVTGG+GYIGSHT +QLL  G+  +++DNL N+    +  ++ L G    + TF + D+R++A +  +        VIHFAGL+AVGESVQKPL Y+DNN+ GT+ L+  M A   KN +FSSSATVYG    +P  E FP     +PYG++KL +E+I  D+ ++  +W   +   F
Sbjct:    3 VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGK---HPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYF 178          

HSP 2 Score: 25.409 bits (54), Expect = 6.258e-38
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  685 IILLRYFNPVXXXPS 729
            I LLRYFNPV   PS
Sbjct:  172 IALLRYFNPVGAHPS 186          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_PASMU (UDP-glucose 4-epimerase OS=Pasteurella multocida GN=galE PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.062e-37
Identity = 83/179 (46.37%), Postives = 120/179 (67.04%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            ILVTGGAGYIGSHTV++LL      VV+DNL N+S  ++ +V ++ G Q   + F++ D+ D A L+ +FA+ +  +VIHFAGL+AVGESVQKP  Y+ NN+ G++ L++ M   G  N VFSSSATVYG P+++P TE   +    NPYG +K  +E+I +D+ ++  E+   I   F
Sbjct:    3 ILVTGGAGYIGSHTVVELLNANKDVVVLDNLCNSSPKSLERVAQITGKQ---VKFYQGDILDTALLQKIFAENQIQSVIHFAGLKAVGESVQKPAEYYMNNVTGSLVLIQEMKKAGVWNFVFSSSATVYGDPEIIPITESCKVGGTTNPYGTSKFMVEQILKDIAKATPEFSITILRYF 178          

HSP 2 Score: 21.557 bits (44), Expect = 1.062e-37
Identity = 8/10 (80.00%), Postives = 9/10 (90.00%), Query Frame = 1
Query:  685 IILLRYFNPV 714
            I +LRYFNPV
Sbjct:  172 ITILRYFNPV 181          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_SALTY (UDP-glucose 4-epimerase OS=Salmonella typhimurium GN=galE PE=3 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 1.062e-37
Identity = 79/179 (44.13%), Postives = 113/179 (63.13%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            +LVTGG+GYIGSHT +QLL  G+  V++DNL N+    +  ++ L G    + TF + D+R++A +  +        VIHFAGL+AVGESV +PL Y+DNN+ GT+ L+  M A   KNL+FSSSATVYG    +P  E FP     +PYG++KL +E+I  D+ ++  EW   +   F
Sbjct:    3 VLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGK---HPTFVEGDIRNEALITEILHDHAIDTVIHFAGLKAVGESVARPLEYYDNNVNGTLRLVSAMRAANVKNLIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPEWSIALLRYF 178          

HSP 2 Score: 25.409 bits (54), Expect = 1.062e-37
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  685 IILLRYFNPVXXXPS 729
            I LLRYFNPV   PS
Sbjct:  172 IALLRYFNPVGAHPS 186          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_NEIGO (UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.148e-36
Identity = 74/171 (43.27%), Postives = 113/171 (66.08%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEF-PLEAMNPYGRTKLFIEEICRDVHRSDSEW 680
            +L+TGG G+IGSHT + L+  GY  V++DNL N+S   + +++++ G    N+ F++ D+RD   L  +F++ +  +VIHFAGL+AVGESV +P  Y+ NN+ G++ L E MA  G   +VFSSSATVYG  + VP TE+  P +  NPYG +K  +E +  D+ ++D  W
Sbjct:    3 VLITGGTGFIGSHTAVSLVQSGYDAVILDNLCNSSAAVLPRLRQITGR---NIPFYQGDIRDCQILRQIFSEHEIESVIHFAGLKAVGESVAEPTKYYGNNVYGSLVLAEEMARAGVLKIVFSSSATVYGDAEKVPYTEDMRPGDTANPYGASKAMVERMLTDIQKADPRW 170          

HSP 2 Score: 23.483 bits (49), Expect = 1.148e-36
Identity = 8/10 (80.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  685 IILLRYFNPV 714
            +ILLRYFNP+
Sbjct:  172 VILLRYFNPI 181          
The following BLAST results are available for this feature:
BLAST of DR405962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GALE_NEIMB2.009e-3946.82UDP-glucose 4-epimerase OS=Neisseria meningitidis ... [more]
GALE_NEIMC2.009e-3946.82UDP-glucose 4-epimerase OS=Neisseria meningitidis ... [more]
GALE_YEREN4.443e-3950.00UDP-glucose 4-epimerase OS=Yersinia enterocolitica... [more]
GALE_ERWAM1.668e-3849.13UDP-glucose 4-epimerase OS=Erwinia amylovora GN=ga... [more]
GALE_DROME1.735e-3847.46Probable UDP-glucose 4-epimerase OS=Drosophila mel... [more]
GALE_SALTI4.804e-3844.69UDP-glucose 4-epimerase OS=Salmonella typhi GN=gal... [more]
GALE_ECOLI6.258e-3843.58UDP-glucose 4-epimerase OS=Escherichia coli (strai... [more]
GALE_PASMU1.062e-3746.37UDP-glucose 4-epimerase OS=Pasteurella multocida G... [more]
GALE_SALTY1.062e-3744.13UDP-glucose 4-epimerase OS=Salmonella typhimurium ... [more]
GALE_NEIGO1.148e-3643.27UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E24 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405962 ID=DR405962|Name=DR405962|organism=Citrus sinensis|type=EST|length=729bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAAGATCATATTGCTGAGAT
ATTTCAATCCTGTTGNNNNNNATCCAAGT
back to top