DR405962

Overview
NameDR405962
Unique NameDR405962
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: EXOB_AZOBR (UDP-glucose 4-epimerase OS=Azospirillum brasilense GN=exoB PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.334e-22
Identity = 63/162 (38.89%), Postives = 84/162 (51.85%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRD 656
            +LVTGGAGYIGSH +  L   G   V +D+L      A+     L             D+     L+ +    +  AV+HFAG   V ESV KPL Y+ NN   ++TLL      G   +VFSS+A VYG P+ VP  E+ P   +NPYG +KL  E++ RD
Sbjct:   11 VLVTGGAGYIGSHVLHALTDAGIPAVTIDDLSAGRREAIPAAVPLVEG----------DIGSAELLDRVMRDHRVDAVMHFAGSIVVPESVVKPLDYYRNNTANSLTLLGACLRAGIDKVVFSSTAAVYGAPESVPIREDAPTVPINPYGASKLMTEQMLRD 162          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_METJA (Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii GN=MJ0211 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.604e-18
Identity = 60/166 (36.14%), Postives = 86/166 (51.81%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSS-ATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHR 665
            ILVTGGAG+IGSH V +L+   Y  +++DNL   ++           N      F   D+RDK   E +  K     VIH A    V  SV+ P+   D N++GTI +LE+M  +    +VF+SS   VYG P  +P  E  P+  ++PYG +K   EE  +  +R
Sbjct:    2 ILVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGNK----------NNINPKAEFVNADIRDKDLDEKINFK-DVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSGGAVYGEPNYLPVDENHPINPLSPYGLSKYVGEEYIKLYNR 156          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_MYCPN (UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae GN=galE PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.184e-16
Identity = 62/171 (36.26%), Postives = 88/171 (51.46%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLD-NASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVM-AAHGCKNLVFSSSATVYGWPKVVPCTEEFPLE---AMNPYGRTKLFIEEICRDVHRS 668
            +LV GG GYIGS  + QLL   Y  V V  +D N + +A+  +          +  H ++L D+A L    A+     V HFA   +V ES ++PL YFD+NL+GT+ LL  +        L FSS+A V+G    +P  E   LE   A NPYG +K   E + + + RS
Sbjct:    8 VLVLGGLGYIGSCFIDQLLKQ-YPDVTVSVIDINHTSLALQLLPR-------QVNVHFVNLLDRAQLTDTIAQINPDVVFHFAAKTSVKESTEQPLTYFDHNLVGTLNLLHALKELQKPIQLFFSSTAAVFGSASTLPIPENLVLEETLASNPYGISKFLSEIVLQTLTRS 170          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: YCL2_ECO11 (Uncharacterized 37.6 kDa protein in cld 5'region OS=Escherichia coli O111:H- PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.520e-15
Identity = 52/154 (33.77%), Postives = 87/154 (56.49%), Query Frame = 3
Query:  174 LVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVK-ELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVP-CTEEFPLEAMNPYGRTK 629
            LVTG AG+IG H   +LL  G++ V +DNL++  ++++ + + EL    G    FHK+DL D+  +  LFA   F  V       AV  S++ P  Y D+NL G + +LE    +  ++L+++SS++VYG  + +P  T++     ++ Y  TK
Sbjct:    4 LVTGAAGFIGFHVSKRLLEAGHQVVGIDNLNDYYDVSLKQARLELLAQPG--FQFHKIDLADREGMTDLFASGHFERVFISPHRLAVRYSLENPHAYADSNLTGFLNILEGCRHNKIQHLLYASSSSVYGLNRKMPFSTDDSVDHPVSLYAATK 155          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: TGDS_DICDI (dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.024e-14
Identity = 58/187 (31.02%), Postives = 87/187 (46.52%), Query Frame = 3
Query:  153 DSMAKNILVTGGAGYIGSHTVLQLL--LGGYKTVVVDNLDNASEI--AVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKV-----------VPCTEEFPLEAMNPYGRTKLFIEEICRDVHRS 668
            D   + IL+TGGAG+IGSH  + L       K +V+D LD  S I      +KEL      N  F+K ++ D   LE +F K K   VIH A    V  S ++ + + +NN++GT  LLE    +  K  ++ S+  VYG   +               E+  L   NPY  +K   E + +  ++S
Sbjct:    6 DLFIQKILITGGAGFIGSHLAIYLTKKFKNSKIIVLDKLDYCSNINNLGCVLKEL------NFKFYKGNILDSELLENIFEKEKIDIVIHLAAYTHVDNSFKQSIKFTENNILGTHYLLETCKNYKLKKFIYVSTDEVYGSGLIEDNDDNNNSINQSSNEKSILNPTNPYSASKAGAEHLVQSYYKS 186          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: CAPI_STAAU (Protein capI OS=Staphylococcus aureus GN=capI PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.083e-14
Identity = 41/130 (31.54%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYG 560
            IL+TG AG+IGSH   +L+  G+  + VD++++   +++ K   L     +N TF+K+ L +   L  +F   +   V++ A    V  S++ P  Y D+N++G + +LE       +NL+++SS++VYG
Sbjct:    3 ILITGTAGFIGSHLAKKLIKQGHYVIGVDSINDYYSVSL-KEDRLKSIGKENFTFNKVKLENYDDLSKVFVDEQPEVVVNLAAQAGVRYSIENPRTYIDSNIVGFMNILECSRHFNIQNLIYASSSSVYG 131          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: Y1055_METJA (Uncharacterized protein MJ1055 OS=Methanocaldococcus jannaschii GN=MJ1055 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.303e-13
Identity = 48/146 (32.88%), Postives = 77/146 (52.74%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGY---KTVVVDNLDNA-SEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEE 590
            KNILVTG AG+IG H + + L+  Y   K + +DNL+N  + +   K  E+  N  +N TF KLD  D   L       +   ++H      V  S+Q P  Y  +N +GT+ + E       + +V++SS++VYG  + +P +E+
Sbjct:    4 KNILVTGSAGFIGFH-LSKYLMDNYEDLKVIGIDNLNNYYNPVLKEKRNEILKNY-ENYTFIKLDFSDWDDLVENLKDKEIDLIVHLGAQAGVRYSLQNPWAYIKSNEMGTLNIFEFARRFDIEKVVYASSSSVYGGNRKIPFSED 147          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_MYCGE (UDP-glucose 4-epimerase OS=Mycoplasma genitalium GN=galE PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.339e-13
Identity = 56/173 (32.37%), Postives = 86/173 (49.71%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMA-AHGCKNLVFSSSATVYGWPKVVPCTEEFPL---EAMNPYGRTKLFIEEICRDVHRSDSE 677
            + + GG GYIGS      +      ++V  +DN     V K+ +  G     + F+  DL D+  L  + A  +   V HFA   +V ESV  PL YFD N+IGT+ L+  ++       L F+SSA VYG       +EE  +   +A NPYG +K F++E+  +    +S+
Sbjct:    8 VAIVGGIGYIGS-CFASFIKEQNDKLIVTVIDNNKNNHVIKLLKKIG-----IEFYFADLLDRHKLTEVIAAIQPDVVFHFAAKTSVSESVHNPLKYFDCNVIGTLNLISAISNLQKPIKLFFASSAAVYGQTTNSYISEEIVITETQATNPYGLSK-FLDELILNAVAKNSQ 173          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: TGDS_BOVIN (dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.586e-13
Identity = 52/167 (31.14%), Postives = 76/167 (45.51%), Query Frame = 3
Query:  141 VSPLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIE 641
            + P DS AK +LVTGGAG+I SH ++  L+  Y   ++ NLD     A  K  E   N+  N  F + D+ D   ++ LF   K   V+HFA    V  S  +   +   N+ GT  L+        +  ++ S+  VYG        E  P +  NPY  +K   E
Sbjct:   10 LGPPDSFAKRVLVTGGAGFIASHMIVS-LVEDYPNYMIINLDKLDYCASLKNLETISNK-QNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAE 174          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: TGDS_MOUSE (dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.635e-12
Identity = 52/165 (31.52%), Postives = 75/165 (45.45%), Query Frame = 3
Query:  147 PLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIE 641
            P  S AK +LVTGGAG+I SH ++ L+   Y   ++ NLD     A  K  E   N+  N  F + D+ D   ++ LF   K   V+HFA    V  S  +   +   N+ GT  L+      G +  ++ S+  VYG        E  P +  NPY  +K   E
Sbjct:   12 PPGSFAKRVLVTGGAGFIASHVIVSLV-EDYPDYMIVNLDKLDYCASLKNLEPVSNK-QNYKFIQGDICDSHFVKLLFEVEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVNAAYEAGVEKFIYVSTDEVYGGSLDQEFDESSPKQPTNPYASSKAAAE 174          
The following BLAST results are available for this feature:
BLAST of DR405962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
EXOB_AZOBR1.334e-2238.89UDP-glucose 4-epimerase OS=Azospirillum brasilense... [more]
GALE_METJA2.604e-1836.14Putative UDP-glucose 4-epimerase OS=Methanocaldoco... [more]
GALE_MYCPN3.184e-1636.26UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae G... [more]
YCL2_ECO113.520e-1533.77Uncharacterized 37.6 kDa protein in cld 5'region O... [more]
TGDS_DICDI1.024e-1431.02dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium di... [more]
CAPI_STAAU5.083e-1431.54Protein capI OS=Staphylococcus aureus GN=capI PE=3... [more]
Y1055_METJA4.303e-1332.88Uncharacterized protein MJ1055 OS=Methanocaldococc... [more]
GALE_MYCGE7.339e-1332.37UDP-glucose 4-epimerase OS=Mycoplasma genitalium G... [more]
TGDS_BOVIN9.586e-1331.14dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TG... [more]
TGDS_MOUSE1.635e-1231.52dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E24 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405962 ID=DR405962|Name=DR405962|organism=Citrus sinensis|type=EST|length=729bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAAGATCATATTGCTGAGAT
ATTTCAATCCTGTTGNNNNNNATCCAAGT
back to top