DN135077
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN135077 vs. ExPASy Swiss-Prot
Match: RBS_SYNP6 (Ribulose bisphosphate carboxylase small chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cbbS PE=1 SV=3) HSP 1 Score: 71.2478 bits (173), Expect = 2.687e-12 Identity = 27/55 (49.09%), Postives = 39/55 (70.91%), Query Frame = 3 Query: 81 YWTMWKLPMFGCNDSSQILNEIQECKKAYPNAYIRCLAFNNQKQGQCMSFLIQKP 245 YWTMWKLP+F C Q+L+E++EC+ Y + YIR F+N KQ Q +SF++ +P Sbjct: 54 YWTMWKLPLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 108
BLAST of DN135077 vs. ExPASy Swiss-Prot
Match: RBS_SYNY3 (Ribulose bisphosphate carboxylase small chain OS=Synechocystis sp. (strain PCC 6803) GN=cbbS PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.334e-11 Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 3 Query: 81 YWTMWKLPMFGCNDSSQILNEIQECKKAYPNAYIRCLAFNNQKQGQCMSFLIQKP 245 +WTMWKLP FG ++++L E++EC+ PN YIR + F+N KQ Q +SF++ KP Sbjct: 52 FWTMWKLPFFGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKP 106
BLAST of DN135077 vs. ExPASy Swiss-Prot
Match: RBS_SYNP2 (Ribulose bisphosphate carboxylase small chain OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cbbS PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.334e-11 Identity = 25/55 (45.45%), Postives = 41/55 (74.55%), Query Frame = 3 Query: 81 YWTMWKLPMFGCNDSSQILNEIQECKKAYPNAYIRCLAFNNQKQGQCMSFLIQKP 245 +WT+WKLP+F + + ++LNE++EC+ Y + YIR + F+N KQ Q +SF++ KP Sbjct: 52 HWTLWKLPLFNASSAQEVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106 The following BLAST results are available for this feature:
BLAST of DN135077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 113
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN135077 ID=DN135077; Name=DN135077; organism=Citrus sinensis; type=EST; length=490bpback to top |