DN134911
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DN134911 vs. ExPASy Swiss-Prot
Match: THIO_CHLAA (Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3) HSP 1 Score: 67.781 bits (164), Expect = 5.250e-11 Identity = 35/89 (39.33%), Postives = 55/89 (61.80%), Query Frame = 3 Query: 129 QKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFL-KVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTI 392 +K ++K VVVDF A WCGPCR IAP L +LA + L + KV+ D+ A+ ++ +PT + K+G+ V ++VGA+ E + + I Sbjct: 14 EKVLKSKTPVVVDFWAPWCGPCRVIAPILDKLAGEYAGRLTIAKVNTDDNVQYASQLGIQGIPTLVIFKDGREVGRLVGARPEAMYREI 102
BLAST of DN134911 vs. ExPASy Swiss-Prot
Match: THIO1_DROME (Thioredoxin-1 OS=Drosophila melanogaster GN=dhd PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.856e-11 Identity = 31/100 (31.00%), Postives = 65/100 (65.00%), Query Frame = 3 Query: 102 TVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPN-VLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAK 398 T+ ++++++ +++ +L+V+DF A+WCGPC+ + + LA+K + + LK+DVD+ + + + V +MPTF+FL++ + + GA + +L +AK Sbjct: 6 TMNDYHKRIEAADD--KLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103
BLAST of DN134911 vs. ExPASy Swiss-Prot
Match: TRXL2_ARATH (Thioredoxin-like 2, chloroplastic OS=Arabidopsis thaliana GN=At4g26160 PE=2 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 8.954e-11 Identity = 38/116 (32.76%), Postives = 66/116 (56.90%), Query Frame = 3 Query: 63 WQQQKRDKSXXCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLK--EGKIVDKVVG-AKKEELQQTIAKH 401 W+++ + E + L+ + + +LV+VDF +WCG CR + P L + AK+ PN+LFLKV+ DE KS+ V+ +P F F + +G++ AK ++L++ I +H Sbjct: 87 WERKAGPNMIDITSAEQFLNALKDAGD--RLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKVNFDENKSLCKSLNVKVLPYFHFYRGADGQVESFSCSLAKFQKLREAIERH 200 The following BLAST results are available for this feature:
BLAST of DN134911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 113
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN134911 ID=DN134911; Name=DN134911; organism=Citrus sinensis; type=EST; length=629bpback to top |