DN134859

Overview
NameDN134859
Unique NameDN134859
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length413
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6283 contig Csv1_Contig6283:895..1308. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_GNEPA (Photosystem II reaction center protein I OS=Gnetum parvifolium GN=psbI PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.011e-13
Identity = 33/36 (91.67%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLK+FVYTVVIFFVSLF+FGFLSNDPGRNPGR+E
Sbjct:    1 MLTLKVFVYTVVIFFVSLFLFGFLSNDPGRNPGRKE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_PSEMZ (Photosystem II reaction center protein I OS=Pseudotsuga menziesii GN=psbI PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.046e-12
Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVY VVIFF+SLFIFGFLSNDPGRNPGR+E
Sbjct:    1 MLTLKLFVYAVVIFFISLFIFGFLSNDPGRNPGRKE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_PSEJA (Photosystem II reaction center protein I OS=Pseudotsuga japonica GN=psbI PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.046e-12
Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVY VVIFF+SLFIFGFLSNDPGRNPGR+E
Sbjct:    1 MLTLKLFVYAVVIFFISLFIFGFLSNDPGRNPGRKE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_PINTH (Photosystem II reaction center protein I OS=Pinus thunbergii GN=psbI PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.366e-12
Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVY VV+FF+SLFIFGFLSNDPGRNPGR+E
Sbjct:    1 MLTLKLFVYAVVVFFISLFIFGFLSNDPGRNPGRKE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_PINKO (Photosystem II reaction center protein I OS=Pinus koraiensis GN=psbI PE=3 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 1.366e-12
Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVY VV+FF+SLFIFGFLSNDPGRNPGR+E
Sbjct:    1 MLTLKLFVYAVVVFFISLFIFGFLSNDPGRNPGRKE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_ZYGCR (Photosystem II reaction center protein I OS=Zygnema circumcarinatum GN=psbI PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.785e-12
Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTV+IFFVSLF+FGFLSNDP RNPGR+E
Sbjct:    1 MLTLKLFVYTVIIFFVSLFVFGFLSNDPSRNPGRKE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_PSINU (Photosystem II reaction center protein I OS=Psilotum nudum GN=psbI PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.785e-12
Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVI F+SLF+FGFLSNDPGRNPGR+E
Sbjct:    1 MLTLKLFVYTVVILFISLFVFGFLSNDPGRNPGRKE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_CUSRE (Photosystem II reaction center protein I OS=Cuscuta reflexa GN=psbI PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.785e-12
Identity = 34/36 (94.44%), Postives = 34/36 (94.44%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            M TLKLFVYTVVIFFVSLFIFGFLSNDP RNPGREE
Sbjct:    1 MFTLKLFVYTVVIFFVSLFIFGFLSNDPRRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_CUSEX (Photosystem II reaction center protein I OS=Cuscuta exaltata GN=psbI PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.785e-12
Identity = 34/36 (94.44%), Postives = 34/36 (94.44%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            M TLKLFVYTVVIFFVSLFIFGFLSNDP RNPGREE
Sbjct:    1 MFTLKLFVYTVVIFFVSLFIFGFLSNDPRRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_CHAGL (Photosystem II reaction center protein I OS=Chaetosphaeridium globosum GN=psbI PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.785e-12
Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLK+FVYTVVIFFVSLFIFGFLSNDP RNPGR+E
Sbjct:    1 MLTLKIFVYTVVIFFVSLFIFGFLSNDPARNPGRKE 36          
The following BLAST results are available for this feature:
BLAST of DN134859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
PSBI_GNEPA8.011e-1391.67Photosystem II reaction center protein I OS=Gnetum... [more]
PSBI_PSEMZ1.046e-1291.67Photosystem II reaction center protein I OS=Pseudo... [more]
PSBI_PSEJA1.046e-1291.67Photosystem II reaction center protein I OS=Pseudo... [more]
PSBI_PINTH1.366e-1288.89Photosystem II reaction center protein I OS=Pinus ... [more]
PSBI_PINKO1.366e-1288.89Photosystem II reaction center protein I OS=Pinus ... [more]
PSBI_ZYGCR1.785e-1288.89Photosystem II reaction center protein I OS=Zygnem... [more]
PSBI_PSINU1.785e-1288.89Photosystem II reaction center protein I OS=Psilot... [more]
PSBI_CUSRE1.785e-1294.44Photosystem II reaction center protein I OS=Cuscut... [more]
PSBI_CUSEX1.785e-1294.44Photosystem II reaction center protein I OS=Cuscut... [more]
PSBI_CHAGL1.785e-1291.67Photosystem II reaction center protein I OS=Chaeto... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca02d06 Developing fruit albedo at 80 DAFB in Vulnus5 vector Citrus sinensis cDNA clone wca02d06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN134859 ID=DN134859|Name=DN134859|organism=Citrus sinensis|type=EST|length=413bp
ATCTATTCTCTTTTTCCTTTCCCCAAAAACCTGATTTGGAGATTGTGTAA
TGCTTACTCTCAAACTCTTTGTTTACACCGTAGTGATATTCTTTGTTTCG
CTCTTCATCTTCGGATTCCTGTCTAATGATCCAGGGCGTAATCCCGGACG
CGAAGAATAAAAAAGGAAGGAGTTGCTTACTTTATTCGTATAAACGTTCT
TAGGATTTTTTGATTCCCAGTTACTATTAAAAATAAAGTAAAAGTGTTCG
CTAAAGTTAAATTTGAAAAATACCAAGCCATCGCCCGAAACGGAAAGAGA
GGGATTCGAACCCTCGGTACGAAGAACTCGTACACCGGATTACCAATCCG
ACGCTTTAATCCACTCAGCCATCTCTCCTAATTGAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA
back to top