DC900355

Overview
NameDC900355
Unique NameDC900355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length455
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9788 contig Csv1_Contig9788:70..524. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_CANFA (40S ribosomal protein S18 OS=Canis familiaris GN=RPS18 PE=1 SV=3)

HSP 1 Score: 188.348 bits (477), Expect = 1.061e-47
Identity = 87/125 (69.60%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+ KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.061e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_BOVIN (40S ribosomal protein S18 OS=Bos taurus GN=RPS18 PE=2 SV=3)

HSP 1 Score: 188.348 bits (477), Expect = 1.061e-47
Identity = 87/125 (69.60%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+ KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.061e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_CHLRE (40S ribosomal protein S18 OS=Chlamydomonas reinhardtii GN=RPS18 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.802e-47
Identity = 87/124 (70.16%), Postives = 107/124 (86.29%), Query Frame = 2
Query:   41 SLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            SLV  +DFQHILR+LNTNVDGK KIM+A+T+I+GIGRR +N+VCKKA+VD+ K AGE SA EL+ +M +VANPR +KIPDWFLNRQKD+K G++SQ+ S+ LD  +RDDLERLKKIR HRGLRH
Sbjct:    3 SLVQGDDFQHILRLLNTNVDGKNKIMYAMTAIRGIGRRFSNLVCKKAEVDLRKAAGECSADELERMMGIVANPRAYKIPDWFLNRQKDHKTGRFSQLTSSQLDTVMRDDLERLKKIRGHRGLRH 126          

HSP 2 Score: 23.0978 bits (48), Expect = 1.802e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  128 WGLRVRGQHTKT 139          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_SCHPO (40S ribosomal protein S18 OS=Schizosaccharomyces pombe GN=rps18a PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 3.687e-47
Identity = 86/126 (68.25%), Postives = 107/126 (84.92%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            MSLV  ++FQHILR+LNTNVDGK K+MFA+T IKG+GRR ANIVCKKAD+DM+KRAGEL+  EL+ ++ ++ NP QFKIP WFLNRQKD  DGK  Q+++N +D KLR+DLERLKKI+ HRGLRH+
Sbjct:    1 MSLVVPDNFQHILRLLNTNVDGKVKVMFAMTQIKGVGRRYANIVCKKADIDMSKRAGELTTEELERIVTIIQNPSQFKIPSWFLNRQKDINDGKSFQLLANNVDSKLREDLERLKKIQTHRGLRHA 126          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_SPOFR (40S ribosomal protein S18 OS=Spodoptera frugiperda GN=RpS18 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 8.835e-47
Identity = 83/125 (66.40%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  + FQHILR++NTN+DGK+K+MFA+T+IKG+GRR +NIV KKAD+D++KRAGE +  E++ ++ +++NPRQ+KIPDWFLNRQKD  DGKYSQ+ S+ LD KLR+DLERLKKIR HRG+RH
Sbjct:    1 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECTEEEVEKIVTIMSNPRQYKIPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAHRGMRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 8.835e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_DROME (40S ribosomal protein S18 OS=Drosophila melanogaster GN=RpS18 PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.040e-44
Identity = 82/125 (65.60%), Postives = 105/125 (84.00%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILR++NTN+DGK+K+  A+T+IKG+GRR +NIV KKADVD+ KRAGE +  E+D ++ +++NP Q+K+P+WFLNRQKD  DGKY Q+ S+ LD KLRDDLERLKKIR+HRGLRH
Sbjct:    1 MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADVDLTKRAGECTEEEVDKVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTSSNLDSKLRDDLERLKKIRSHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.040e-44
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_DICDI (40S ribosomal protein S18 OS=Dictyostelium discoideum GN=rps18 PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 8.500e-44
Identity = 79/124 (63.71%), Postives = 102/124 (82.26%), Query Frame = 2
Query:   41 SLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            SLV   +FQHI+R+ NTNVDG++KI +ALT +KG+GRR AN+VCKKAD+D +KRAGELS  E++ L  ++ +PRQ+ IP WFLNRQKD KDGKYS  ++N +D+K R+DLERLKKIR HRG+RH
Sbjct:    4 SLVFQGEFQHIIRIYNTNVDGRRKIQYALTCVKGVGRRFANLVCKKADIDTSKRAGELSKDEVERLTTIMNHPRQYNIPTWFLNRQKDIKDGKYSHCLANQIDVKFREDLERLKKIRAHRGVRH 127          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_YEAST (40S ribosomal protein S18 OS=Saccharomyces cerevisiae GN=RPS18A PE=1 SV=4)

HSP 1 Score: 166.007 bits (419), Expect = 4.978e-41
Identity = 80/127 (62.99%), Postives = 101/127 (79.53%), Query Frame = 2
Query:   38 MSLVANED--FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E   FQHILR+LNTNVDG  KI++ALT+IKG+GRR +N+VCKKADVD++KRAGEL+  EL+ ++ ++ NP  +KIP WFLNRQ D  DGK    ++N ++ KLRDDLERLKKIR HRG+RH
Sbjct:    1 MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRH 127          

HSP 2 Score: 23.0978 bits (48), Expect = 4.978e-41
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  129 WGLRVRGQHTKT 140          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_ENTHI (40S ribosomal protein S18 OS=Entamoeba histolytica GN=RPS18 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.006e-36
Identity = 67/124 (54.03%), Postives = 99/124 (79.84%), Query Frame = 2
Query:   41 SLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            ++ +  +FQH+LRV NTN+DG++K+ +ALT IKG GRR A +VCK+A +D+NKRAG ++ AE++ ++ ++     +KIP WFLNRQKD KDGK SQ+++NA++ +LR+D+E LKK+R HRGLRH
Sbjct:    3 TVTSESEFQHMLRVCNTNLDGRRKVPYALTGIKGCGRRYAYLVCKRAGIDVNKRAGLMTPAEIEKIVDILTTQLNYKIPVWFLNRQKDNKDGKDSQLIANAVETRLREDIEALKKMRAHRGLRH 126          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METST (30S ribosomal protein S13P OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rps13p PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.181e-25
Identity = 49/122 (40.16%), Postives = 81/122 (66.39%), Query Frame = 2
Query:   47 VANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +A ++F+H++R+   +VDG   I  ALT I+GIG+  A  +CK  D+D + + G +    +  +  V+ NP++F IP+WFLNR+ DY+ G+   ++ + L+M LRDDL R+K IR+++G RH
Sbjct:    1 MAEQEFRHMVRITRKDVDGNSTIATALTEIRGIGKAFAIAICKVLDLDQDAQIGYIDDESVKQIEAVLENPQEFGIPEWFLNRRNDYETGETKHLIESDLNMTLRDDLNRMKMIRSYKGKRH 122          
The following BLAST results are available for this feature:
BLAST of DC900355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS18_CANFA1.061e-4769.6040S ribosomal protein S18 OS=Canis familiaris GN=R... [more]
RS18_BOVIN1.061e-4769.6040S ribosomal protein S18 OS=Bos taurus GN=RPS18 P... [more]
RS18_CHLRE1.802e-4770.1640S ribosomal protein S18 OS=Chlamydomonas reinhar... [more]
RS18_SCHPO3.687e-4768.2540S ribosomal protein S18 OS=Schizosaccharomyces p... [more]
RS18_SPOFR8.835e-4766.4040S ribosomal protein S18 OS=Spodoptera frugiperda... [more]
RS18_DROME1.040e-4465.6040S ribosomal protein S18 OS=Drosophila melanogast... [more]
RS18_DICDI8.500e-4463.7140S ribosomal protein S18 OS=Dictyostelium discoid... [more]
RS18_YEAST4.978e-4162.9940S ribosomal protein S18 OS=Saccharomyces cerevis... [more]
RS18_ENTHI1.006e-3654.0340S ribosomal protein S18 OS=Entamoeba histolytica... [more]
RS13_METST5.181e-2540.1630S ribosomal protein S13P OS=Methanosphaera stadt... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900355 VSS Citrus sinensis cDNA clone VS28917 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900355 ID=DC900355|Name=DC900355|organism=Citrus sinensis|type=EST|length=455bp
CCTCTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGG
CGAACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGAC
GGGAAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAG
GCGACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGA
GGGCCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTT
GCAAATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAA
GGATTACAAAGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACA
TGAAGTTGAGAGATGATTTGGAGCGTCTGAAGAAGATCAGGAACCACCGT
GGTCTCAGGCACTCTGGGGTCTTCGTGTCCGTGGACACACACAGACACGC
GCGGA
back to top