DC900355

Overview
NameDC900355
Unique NameDC900355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length455
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9788 contig Csv1_Contig9788:70..524. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METTH (30S ribosomal protein S13P OS=Methanobacterium thermoautotrophicum GN=rps13p PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 9.771e-24
Identity = 46/119 (38.66%), Postives = 80/119 (67.23%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            E+F+H++R+   ++DG + +  ALTSIKG+G+ L+  +   A  D+N+R G LS  E++ L   + NP ++ IP W +NR+ DY+ G+   ++ + L+M LR+DL R++K R+++G RH
Sbjct:    3 EEFKHMVRIARKDIDGNKTMENALTSIKGVGKALSRAIIMSAGYDLNQRIGYLSDEEIERLEEAIKNPAKYNIPSWMINRRNDYETGEDKHLIESDLEMCLREDLNRMRKTRSYKGRRH 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METS3 (30S ribosomal protein S13P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps13p PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 9.771e-24
Identity = 47/119 (39.50%), Postives = 81/119 (68.07%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +DF+H++R+   +VDG + I  ALT IKG+G  L+  +C+  D+D   + G ++  ++  +  ++ NP++F IP+W LNR++DY+ G+   ++ + LDM LRDDL R+KK R+++G RH
Sbjct:    3 DDFKHLVRISRKDVDGNKTIEQALTEIKGVGISLSTTMCRTLDLDSEAQIGYIADEDVLKIEEILENPQKFNIPNWMLNRREDYETGENIHLIESDLDMTLRDDLNRMKKTRSYKGRRH 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRHO (30S ribosomal protein S13P OS=Pyrococcus horikoshii GN=rps13p PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 3.143e-22
Identity = 47/118 (39.83%), Postives = 80/118 (67.80%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            DF+HI+RV   ++DG +++ +ALT+IKG+G   A +VC+ A +D   +AG L+  ++  +  ++ +P    IP W +NR KDY+ GK   +++  LDM +R+D+ RL++IR +RG+RH
Sbjct:    3 DFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVSHGIPRWAVNRPKDYETGKDLHLITAKLDMAIREDIMRLRRIRAYRGIRH 120          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METKA (30S ribosomal protein S13P OS=Methanopyrus kandleri GN=rps13p PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 5.361e-22
Identity = 48/124 (38.71%), Postives = 83/124 (66.94%), Query Frame = 2
Query:   47 VANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNL--MVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +A+++ + I+R+ + ++DG +K+ +ALT IKGIG R+A  +C++  +D  K+ GELS  E++ +   +   +  +  IP W  NRQKDY+ G+   +V   L+M ++ D++RLKKIR +RG+RH
Sbjct:    1 MADDEVKPIVRIADVDLDGHKKVPYALTGIKGIGIRMAYAICRELGLDEEKKLGELSDEEIERIEEEIKKLSEGESNIPSWMYNRQKDYETGEDMHLVGAELEMTVKQDIDRLKKIRAYRGIRH 124          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRFU (30S ribosomal protein S13P OS=Pyrococcus furiosus GN=rps13p PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 7.002e-22
Identity = 47/118 (39.83%), Postives = 81/118 (68.64%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +F+HI+RV   ++DG +++ +ALT+IKGIG   A +VC+ A +D   +AG L+  ++  +  ++A+P    IP W +NR KDY+ G+   +++  LDM +R+D+ RL++IR +RG+RH
Sbjct:    3 NFRHIVRVAGVDLDGNKQLRWALTAIKGIGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILADPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRH 120          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METJA (30S ribosomal protein S13P OS=Methanocaldococcus jannaschii GN=rps13p PE=3 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 7.002e-22
Identity = 47/120 (39.17%), Postives = 79/120 (65.83%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            N +F++++RV  T++DG +K++ AL  I G+G  +A  + + A +D NK AG L+  E+  +  V+A+P +F IP W  NR+KDY  G+   V+ + L +  ++D+ RLK+IR +RG+RH
Sbjct:    3 NSEFKYLIRVSRTDLDGNKKLIMALQDIYGVGEAMARAIVRVAKLDPNKLAGYLTEEEVKKIEEVLADPAKFGIPSWMFNRRKDYVTGEDKHVIESDLMIIKQEDINRLKRIRCYRGIRH 122          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRAB (30S ribosomal protein S13P OS=Pyrococcus abyssi GN=rps13p PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 9.145e-22
Identity = 46/118 (38.98%), Postives = 80/118 (67.80%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            DF+HI+RV   ++DG +++ +ALT+IKG+G   A +VC+ A +D   +AG L+  ++  +  ++ +P    IP W +NR KDY+ G+   +++  LDM +R+D+ RL++IR +RG+RH
Sbjct:    3 DFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRH 120          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_HYPBU (30S ribosomal protein S13P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=rps13p PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.194e-21
Identity = 48/124 (38.71%), Postives = 80/124 (64.52%), Query Frame = 2
Query:   44 LVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            +++ + +++I+R+L T++ G  K+ + L  +KGIG  LA  +C+   +D NKR G L+ AE++ +   +ANP    IP W LNR+KDY+ GK   +V   L   ++ D+ER K+IR+ RG+RH+
Sbjct:    1 MLSEQQYRYIVRILGTDIPGDLKVPYGLALVKGIGVNLAYALCRLLGIDPNKRIGFLTDAEIEKIEKAMANPLAIGIPVWMLNRRKDYETGKDLHLVGADLIYYVKRDIEREKRIRSWRGIRHA 124          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PICTO (30S ribosomal protein S13P OS=Picrophilus torridus GN=rps13p PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.475e-21
Identity = 45/120 (37.50%), Postives = 78/120 (65.00%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            NE+FQ+I+R+ N +++G++ +  AL  +KGIG RL+  + KK D+D ++R GEL   +++ L   +       IP W  N ++D   GK   +VSN LD+++ DD+  +KK+R+++G+RH
Sbjct:    8 NENFQYIVRIANKDLNGERPLKLALADLKGIGLRLSETIAKKLDLDPDQRIGELGEDKIEELRKYIEGKVYDGIPYWMYNHRRDITTGKDFNLVSNDLDLQINDDINLMKKMRSYKGIRH 127          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_PYRKO (30S ribosomal protein S13P OS=Pyrococcus kodakaraensis GN=rps13p PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.011e-20
Identity = 47/119 (39.50%), Postives = 78/119 (65.55%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            E+F+HI+RV   ++DG +++ +ALT IKGIG   A +V + A +D   +AG L+  ++  +  ++A+P    IP W +NR KDY+ GK   +++  L M  R+D+ RL++IR +RG+RH
Sbjct:    3 ENFRHIVRVAGVDIDGHKQVRWALTGIKGIGINFATMVLRVAGIDPFMKAGYLTDEQVKKIEEILADPVAHGIPAWAVNRPKDYETGKDMHLITAKLVMAWREDVNRLRRIRAYRGIRH 121          
The following BLAST results are available for this feature:
BLAST of DC900355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS13_METTH9.771e-2438.6630S ribosomal protein S13P OS=Methanobacterium the... [more]
RS13_METS39.771e-2439.5030S ribosomal protein S13P OS=Methanobrevibacter s... [more]
RS13_PYRHO3.143e-2239.8330S ribosomal protein S13P OS=Pyrococcus horikoshi... [more]
RS13_METKA5.361e-2238.7130S ribosomal protein S13P OS=Methanopyrus kandler... [more]
RS13_PYRFU7.002e-2239.8330S ribosomal protein S13P OS=Pyrococcus furiosus ... [more]
RS13_METJA7.002e-2239.1730S ribosomal protein S13P OS=Methanocaldococcus j... [more]
RS13_PYRAB9.145e-2238.9830S ribosomal protein S13P OS=Pyrococcus abyssi GN... [more]
RS13_HYPBU1.194e-2138.7130S ribosomal protein S13P OS=Hyperthermus butylic... [more]
RS13_PICTO3.475e-2137.5030S ribosomal protein S13P OS=Picrophilus torridus... [more]
RS13_PYRKO1.011e-2039.5030S ribosomal protein S13P OS=Pyrococcus kodakarae... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900355 VSS Citrus sinensis cDNA clone VS28917 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900355 ID=DC900355|Name=DC900355|organism=Citrus sinensis|type=EST|length=455bp
CCTCTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGG
CGAACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGAC
GGGAAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAG
GCGACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGA
GGGCCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTT
GCAAATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAA
GGATTACAAAGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACA
TGAAGTTGAGAGATGATTTGGAGCGTCTGAAGAAGATCAGGAACCACCGT
GGTCTCAGGCACTCTGGGGTCTTCGTGTCCGTGGACACACACAGACACGC
GCGGA
back to top