DC900355

Overview
NameDC900355
Unique NameDC900355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length455
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9788 contig Csv1_Contig9788:70..524. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_SULTO (30S ribosomal protein S13P OS=Sulfolobus tokodaii GN=rps13p PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 7.246e-19
Identity = 43/120 (35.83%), Postives = 76/120 (63.33%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            + F++I+R+   +VDG  K+ +AL  +KGIG   A  +  K  +D ++R GELS  ++  +   + + +  ++P+W  NR+KDY+ G    +V++ L   +R+D+ER KKI++ RG+RHS
Sbjct:    5 QQFKYIVRLFGQDVDGTMKVPYALAMVKGIGYNTARAIVFKLGLDKDRRLGELSDEDIKKIENYLTDKKILEVPNWMYNRRKDYESGIDMHLVTSDLIFYVRNDIEREKKIKSWRGVRHS 124          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METMA (30S ribosomal protein S13P OS=Methanosarcina mazei GN=rps13p PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.236e-18
Identity = 44/120 (36.67%), Postives = 71/120 (59.17%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            NE+ +H++R++NT++ G + + +ALT + GIGRR A ++ K A VD     G L   E+  L   +    +  +P W LNRQKD   G+   ++   + +  R+D+  LKK+R +RGLRH
Sbjct:   17 NEELRHLVRIMNTDLKGAKPVEYALTGLPGIGRRTAILIAKGAGVDPTATLGYLPDEEVAKLDAAIGKFEEI-VPSWMLNRQKDLTTGQDKHLLGTDILLTFREDINNLKKVRAYRGLRH 135          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METBF (30S ribosomal protein S13P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps13p PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.614e-18
Identity = 45/120 (37.50%), Postives = 71/120 (59.17%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            NE+ +H++R++NT++ G + + +ALT + GIGRR A ++ K A VD     G L   E+  L   + N     +P W LNRQKD   G+   ++   + +  R+D+  LKK+R +RGLRH
Sbjct:   17 NEEIRHLVRIMNTDLKGAKPVEYALTGLPGIGRRTAILIAKGAGVDPTATLGYLPDEEVAKLDRAIGNFEGI-VPSWMLNRQKDLATGQDKHLLGTDILLTFREDINNLKKVRAYRGLRH 135          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METHJ (30S ribosomal protein S13P OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=rps13p PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.044e-17
Identity = 44/120 (36.67%), Postives = 71/120 (59.17%), Query Frame = 2
Query:   53 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +++  + +RV NT++DG + ++ +LT IKG+GR  A  + + A V+ N   G+L  A +D +  VV+N    +IP W  NR KD   G    ++   + M + DD+  LKKIR +RG+RH
Sbjct:    5 DQEINYFVRVHNTDLDGTKPVLISLTGIKGVGRHTAKFIAETAGVEKNVLMGKLDEASVDRIREVVSNYAD-RIPVWMSNRPKDVYTGVKRHLLGADVTMTVDDDINLLKKIRAYRGIRH 123          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METBU (30S ribosomal protein S13P OS=Methanococcoides burtonii (strain DSM 6242) GN=rps13p PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.976e-17
Identity = 42/122 (34.43%), Postives = 75/122 (61.48%), Query Frame = 2
Query:   47 VANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +A+E+ +H++R++NT++ GK+ + +ALT I+GIG R + ++     +D N   G LS  ++  L   + +  + ++P W LNRQ D   G+   ++   + + L++DL  LKK R +RGLRH
Sbjct:    1 MADEEIRHLVRIMNTDLQGKKPVKYALTGIRGIGLRTSRVIVDSTGIDPNAVIGYLSDEDIKKLDSTI-DKFEEQLPKWMLNRQFDPLTGENKHLLGQDIILTLKEDLNDLKKSRAYRGLRH 121          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_ARCFU (30S ribosomal protein S13P OS=Archaeoglobus fulgidus GN=rps13p PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.193e-17
Identity = 44/118 (37.29%), Postives = 71/118 (60.17%), Query Frame = 2
Query:   62 FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHS 415
            F+HI+R+ +T++DG + +MFALT IKGIG R A  +  +  VD   + GEL    ++ +   V    +  +P W LNR+KD   G+   ++S  +D     D+ERL K++ +RG+RH+
Sbjct:    3 FKHIVRIADTDLDGNKSLMFALTGIKGIGLRAARCIVNELGVDGRAKLGELDDETIEKVKKFVEEEIE-SLPSWLLNRRKDPYSGQDLHLLSKDVDFARMLDIERLIKMKAYRGVRHA 119          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_HALMA (30S ribosomal protein S13P OS=Haloarcula marismortui GN=rps13p PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.157e-16
Identity = 43/119 (36.13%), Postives = 69/119 (57.98%), Query Frame = 2
Query:   56 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            ED ++ +R+  T++DG + +  ALT + GIG R A I+ +KADVD     G+L    ++ ++  V N     +P+W  N QKDY  G+ +    N L +  R D+ R+K I ++RG+RH
Sbjct:   18 EDIRYFVRIGQTDLDGTKSVERALTELNGIGHRAARIIAQKADVDRRAVFGKLDDDVIERVVERVENFAD-DVPEWMTNHQKDYFTGETTHETGNDLQLTRRQDINRMKMIDSYRGVRH 135          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_METMP (30S ribosomal protein S13P OS=Methanococcus maripaludis GN=rps13p PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.511e-16
Identity = 38/118 (32.20%), Postives = 72/118 (61.02%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +F+H +R+  T+++GK  + +AL  +KGIGR +A  V +  ++D  ++AG L+  ++  +  V+ +P    IP W  NR+KD   G    ++   L + +++D+  +KKIR ++G+RH
Sbjct:    5 EFKHRIRISKTDLEGKNPLEYALQDMKGIGRAMARAVIRVTELDPKQQAGYLADEDVLKIESVLEDPATHGIPSWMFNRKKDVYSGLDKHLIETDLVLTVQEDITNMKKIRCYKGIRH 122          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_AERPE (30S ribosomal protein S13P OS=Aeropyrum pernix GN=rps13p PE=3 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 3.366e-16
Identity = 43/123 (34.96%), Postives = 68/123 (55.28%), Query Frame = 2
Query:   44 LVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +     F++I+R+   ++DG  K+ + L SIKGIG   A  V +   +D  K+ G L+  E+  L  V+ +  Q  +P W  NR+KDY+ GK   ++ + L    R D+ER  KI + RG+RH
Sbjct:    1 MAGETSFKYIVRIAGVDIDGDLKLPYGLASIKGIGYTTAMAVIRMLGLDPEKKVGFLTEEEIRRLDEVLRDITQLGLPKWLYNRRKDYETGKDLHLIGSELIFYARRDIEREMKIGSWRGIRH 123          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS13_THEPD (30S ribosomal protein S13P OS=Thermofilum pendens (strain Hrk 5) GN=rps13p PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.182e-15
Identity = 40/118 (33.90%), Postives = 72/118 (61.02%), Query Frame = 2
Query:   59 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            +F++I+RV   ++ G + +++AL  IKGIG   A  V KK  +D  +  G LS  E++ L   +    +  +P W LNR+KD   G    ++++ L + +R+D+E +KKI++++G+RH
Sbjct:    4 EFRYIVRVAGVDLPGDKALVYALADIKGIGVSTAQAVAKKLGLDPYRLLGTLSEEEVEKLSAALREIEKLGLPPWMLNRRKDPFLGVDRHLITSDLLITVRNDIEFMKKIKSYKGVRH 121          
The following BLAST results are available for this feature:
BLAST of DC900355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS13_SULTO7.246e-1935.8330S ribosomal protein S13P OS=Sulfolobus tokodaii ... [more]
RS13_METMA1.236e-1836.6730S ribosomal protein S13P OS=Methanosarcina mazei... [more]
RS13_METBF1.614e-1837.5030S ribosomal protein S13P OS=Methanosarcina barke... [more]
RS13_METHJ3.044e-1736.6730S ribosomal protein S13P OS=Methanospirillum hun... [more]
RS13_METBU3.976e-1734.4330S ribosomal protein S13P OS=Methanococcoides bur... [more]
RS13_ARCFU5.193e-1737.2930S ribosomal protein S13P OS=Archaeoglobus fulgid... [more]
RS13_HALMA1.157e-1636.1330S ribosomal protein S13P OS=Haloarcula marismort... [more]
RS13_METMP1.511e-1632.2030S ribosomal protein S13P OS=Methanococcus maripa... [more]
RS13_AERPE3.366e-1634.9630S ribosomal protein S13P OS=Aeropyrum pernix GN=... [more]
RS13_THEPD2.182e-1533.9030S ribosomal protein S13P OS=Thermofilum pendens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900355 VSS Citrus sinensis cDNA clone VS28917 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900355 ID=DC900355|Name=DC900355|organism=Citrus sinensis|type=EST|length=455bp
CCTCTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGG
CGAACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGAC
GGGAAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAG
GCGACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGA
GGGCCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTT
GCAAATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAA
GGATTACAAAGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACA
TGAAGTTGAGAGATGATTTGGAGCGTCTGAAGAAGATCAGGAACCACCGT
GGTCTCAGGCACTCTGGGGTCTTCGTGTCCGTGGACACACACAGACACGC
GCGGA
back to top