DC900257

Overview
NameDC900257
Unique NameDC900257
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length735
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2656 contig Csv1_Contig2656:19..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SC132_CANGA (Protein transport protein SEC13-2 OS=Candida glabrata GN=SEC132 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.124e-19
Identity = 58/153 (37.91%), Postives = 86/153 (56.21%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC--AKEGEQWEGRVLKD--FKTPVWSVSWSLTGNLLAVADAN-NVTLWKEAVDGEWQQV 445
            H  GV S+SWAP M   +         V++  S G DN VK+WK  +          L+ H D V +V W+P   L +S +AS S D   ++WT   + +   W+   + +  F+  + SVSWSL+GNLLAV+D + NVT+WKE+ DG+W++V
Sbjct:  150 HKFGVNSISWAPLMKTDSSDDGDETTAVKQFISGGNDNLVKIWKFDDDQETYVVADTLEGHKDAVTAVDWSPTT-LLQSYVASVSNDKQCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKESGDGKWEEV 301          
The following BLAST results are available for this feature:
BLAST of DC900257 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
SC132_CANGA3.124e-1937.91Protein transport protein SEC13-2 OS=Candida glabr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900257 VSS Citrus sinensis cDNA clone VS28601 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900257 ID=DC900257|Name=DC900257|organism=Citrus sinensis|type=EST|length=735bp
CCATCCAGTCGGAGTAACATCTGTTTCATGGGCCCCGGCAATGGCTCCTG
GTGCTTTAGTTGGATTGGGCTTACTGGATCCTGTTCAGAAATTGGCTTCT
TGTGGTTGTGATAATACTGTAAAGGTGTGGAAGATGTATAATGGGATTTG
GAAGATGGATTGCTTCCCTGCCCTTCAGATGCACAGTGATTGGGTGCGGA
GCGTGGCGTGGGCTCCCAACTTGGGTCTTCCAAAATCCACAATTGCAAGT
GCATCACAGGATGGGACAGTTGTTATTTGGACCTGTGCCAAGGAAGGGGA
GCAATGGGAGGGTCGAGTTTTGAAGGATTTTAAGACACCAGTTTGGAGTG
TTTCGTGGTCACTGACTGGAAATTTGTTGGCTGTGGCTGATGCAAATAAT
GTGACATTGTGGAAGGAAGCTGTTGATGGTGAGTGGCAACAAGTGAGTGT
AGTTGAGCCACAGACATAAGGTGTCTTCCTACTTACCCTTTCACAATCAT
TGTGTTCTTTTTTGGACTTATTGGAAGTAGCCTTTCTTACACCTGGTTTA
GTTTTTTTTTTTTCCTTTTTTTTTGGTTGGATTGATTTTGTTGGAATACT
TAATTTGTATTTGGTTAGTTGTTATTCTTTCTTGCCAGATTCAGAAACAA
ATGATGGTGTCTTAATCTCCATATCCATATGTCTGTATTTGTGACTGCCA
ATATTTCTGTTAAATTACATATGAACTCTTTATCC
back to top