DC900254

Overview
NameDC900254
Unique NameDC900254
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length642
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900254_ssr486 microsatellite DC900254_ssr486:486..497. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1669 contig Csv1_Contig1669:758..1399. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_PSEAE (2-oxoisovalerate dehydrogenase subunit beta OS=Pseudomonas aeruginosa GN=bkdA2 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.641e-21
Identity = 52/122 (42.62%), Postives = 79/122 (64.75%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIK 366
            ++R G+ +T++ +G  + + + A   A++ G+  E+IDL++L P D ET+ ASV+KTGR +I+HEA  T GFGAE+ + + E CF  LEAP+ RV G DTP+P   E  Y P   ++  A K
Sbjct:  227 IVRPGAALTVLTYGTMVYVAQAA---ADETGLDAEIIDLRSLWPLDLETIVASVKKTGRCVIAHEATRTCGFGAELMSLVQEHCFHHLEAPIERVTGWDTPYPHAQEWAYFPGPARVGAAFK 345          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_PSEPU (2-oxoisovalerate dehydrogenase subunit beta OS=Pseudomonas putida GN=bkdA2 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.685e-21
Identity = 50/125 (40.00%), Postives = 80/125 (64.00%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTV 375
            + R G+D++++ +G  + + + A   AE+ G+  E+IDL++L P D +T+  SV+KTGR ++ HEA  T GFGAE+ + + E CF  LEAP+ RV G DTP+P   E  Y P  +++  A+K  +
Sbjct:  216 ITRPGNDVSVLTYGTTVYVAQVA---AEESGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVVVHEATRTCGFGAELVSLVQEHCFHHLEAPIERVTGWDTPYPHAQEWAYFPGPSRVGAALKKVM 337          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAAW (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus aureus (strain MW2) GN=pdhB PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 52/128 (40.62%), Postives = 79/128 (61.72%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DI+++ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA + A + ER  L LEAP+ RV   DT +P    E  ++P KN I++  K T+ +
Sbjct:  198 VKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYPFTQAENVWLPNKNDIIEKAKETLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAAU (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus aureus GN=pdhB PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 52/128 (40.62%), Postives = 79/128 (61.72%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DI+++ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA + A + ER  L LEAP+ RV   DT +P    E  ++P KN I++  K T+ +
Sbjct:  198 VKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYPFTQAENVWLPNKNDIIEKAKETLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAAS (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=pdhB PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 52/128 (40.62%), Postives = 79/128 (61.72%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DI+++ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA + A + ER  L LEAP+ RV   DT +P    E  ++P KN I++  K T+ +
Sbjct:  198 VKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYPFTQAENVWLPNKNDIIEKAKETLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAAR (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=pdhB PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 52/128 (40.62%), Postives = 79/128 (61.72%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DI+++ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA + A + ER  L LEAP+ RV   DT +P    E  ++P KN I++  K T+ +
Sbjct:  198 VKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYPFTQAENVWLPNKNDIIEKAKETLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAAN (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus aureus (strain N315) GN=pdhB PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 52/128 (40.62%), Postives = 79/128 (61.72%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DI+++ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA + A + ER  L LEAP+ RV   DT +P    E  ++P KN I++  K T+ +
Sbjct:  198 VKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYPFTQAENVWLPNKNDIIEKAKETLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAAM (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhB PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 52/128 (40.62%), Postives = 79/128 (61.72%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DI+++ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA + A + ER  L LEAP+ RV   DT +P    E  ++P KN I++  K T+ +
Sbjct:  198 VKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYPFTQAENVWLPNKNDIIEKAKETLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAAC (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus aureus (strain COL) GN=pdhB PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.004e-20
Identity = 52/128 (40.62%), Postives = 79/128 (61.72%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DI+++ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA + A + ER  L LEAP+ RV   DT +P    E  ++P KN I++  K T+ +
Sbjct:  198 VKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQPIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYPFTQAENVWLPNKNDIIEKAKETLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_BACST (Pyruvate dehydrogenase E1 component subunit beta OS=Bacillus stearothermophilus GN=pdhB PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.712e-20
Identity = 52/126 (41.27%), Postives = 74/126 (58.73%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            REG DIT++ +GA +    +A  + EKEGIS E++DL+T+ P D ET+  SV KTGR ++  EA    G  A + A I ER  L LEAPV RV   DT +P    E  ++P    +++  K  +N+
Sbjct:  200 REGKDITIIAYGAMVHESLKAAAELEKEGISAEVVDLRTVQPLDIETIIGSVEKTGRAIVVQEAQRQAGIAANVVAEINERAILSLEAPVLRVAAPDTVYPFAQAESVWLPNFKDVIETAKKVMNF 325          
The following BLAST results are available for this feature:
BLAST of DC900254 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
ODBB_PSEAE2.641e-2142.622-oxoisovalerate dehydrogenase subunit beta OS=Pse... [more]
ODBB_PSEPU7.685e-2140.002-oxoisovalerate dehydrogenase subunit beta OS=Pse... [more]
ODPB_STAAW1.004e-2040.63Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAAU1.004e-2040.63Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAAS1.004e-2040.63Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAAR1.004e-2040.63Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAAN1.004e-2040.63Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAAM1.004e-2040.63Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAAC1.004e-2040.63Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_BACST1.712e-2041.27Pyruvate dehydrogenase E1 component subunit beta O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900254 VSS Citrus sinensis cDNA clone VS28295 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900254 ID=DC900254|Name=DC900254|organism=Citrus sinensis|type=EST|length=642bp
GTGATTCGAGAAGGCAGTGACATAACACTTGTTGGCTGGGGAGCACAACT
CTCTATCATGGAGCAGGCCTGTTTAGATGCTGAAAAGGAAGGAATTTCTT
GTGAACTGATAGACCTGAAGACACTAATACCATGGGATAAGGAAACAGTA
GAGGCCTCTGTCAGGAAAACCGGACGACTTCTTATTAGCCACGAAGCTCC
GGTTACTGGAGGTTTTGGTGCTGAAATTTCTGCATCTATCCTTGAACGTT
GTTTCTTAAGATTAGAAGCTCCAGTGGCTCGAGTTTGTGGTCTGGACACT
CCCTTCCCTCTCGTTTTCGAACCATTCTACATGCCCACCAAGAATAAGAT
ATTAGATGCAATCAAATCAACTGTAAATTACTAAGAGGGTAACCATCTCT
ACTGCACAACTGCGGATACACAGGTCCAGAGATGAGTGAAATCCCTGCAA
TAGTTTTGCAGGAGGGGAGGTACCAATGTTCCAATACAAACAAACAATAA
GAAAGTTGTATACTCTCCGGAGTTGCTAATTGTTTGTAAACTGGTGGTAA
TGTTATTGGACTGAGCATGCTCACTTACATTCTGCATGTTTGATATGACA
AGTGCAAATGCCATTCTCATCAATGAAGTCCACTCTTTGTTT
back to top