DC900254

Overview
NameDC900254
Unique NameDC900254
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length642
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900254_ssr486 microsatellite DC900254_ssr486:486..497. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1669 contig Csv1_Contig1669:758..1399. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_BACSU (Pyruvate dehydrogenase E1 component subunit beta OS=Bacillus subtilis GN=pdhB PE=3 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.227e-18
Identity = 49/128 (38.28%), Postives = 76/128 (59.38%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL-VFEPFYMPTKNKILDAIKSTVNY 381
            V REG+D++++ +GA +    +A  + EK+GIS E++DL+T+ P D +T+ ASV KTGR ++  EA    G  A + A I +R  L LEAPV RV   DT FP    E  ++P    +L+  +  + +
Sbjct:  198 VKREGTDLSIITYGAMVHESLKAADELEKDGISAEVVDLRTVSPLDIDTIIASVEKTGRAIVVQEAQKQAGIAANVVAEINDRAILSLEAPVLRVAAPDTVFPFSQAESVWLPNHKDVLETARKVLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_DICDI (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Dictyostelium discoideum GN=pdhB PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.356e-17
Identity = 46/103 (44.66%), Postives = 65/103 (63.11%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFP 309
            V REG D+T+VG+   +S   +A     KEGIS E+I+L+T+ P D ET+  S++KT +L+   E     G GAEISA ++E  F  L+AP+ R+CG D P P
Sbjct:  226 VEREGKDVTIVGFSRIVSNCMEAAEILAKEGISAEVINLRTIRPIDAETIVNSLKKTNKLVTVEEGWAQSGIGAEISALMMEHAFDYLDAPIERICGADVPMP 328          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_RICCN (Pyruvate dehydrogenase E1 component subunit beta OS=Rickettsia conorii GN=pdhB PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.314e-17
Identity = 44/129 (34.11%), Postives = 75/129 (58.14%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIKSTVNY 381
            ++REGS +T+V +  Q+ +   A    + + I CE+IDL+T+ P D ET+  SV+KT RL++  E     G GA I++ +++  F  L+AP+  V G D P P     E   +P+++ +++A+K    Y
Sbjct:  196 ILREGSSVTIVTFSIQVKLALDAANFVQNDNIDCEVIDLRTIKPLDTETIIESVKKTNRLVVVEEGWFFAGVGASIASIVMKEAFDYLDAPIEIVSGKDLPLPYAVNLETLALPSESDVIEAVKKVCYY 324          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_RICFE (Pyruvate dehydrogenase E1 component subunit beta OS=Rickettsia felis GN=pdhB PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.022e-17
Identity = 44/129 (34.11%), Postives = 75/129 (58.14%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIKSTVNY 381
            ++REGS +T+V +  Q+ +   A    + + I CE+IDL+T+ P D +T+  SV+KT RL+I  E     G GA I++ +++  F  L+AP+  V G D P P     E   +P+++ +++A+K    Y
Sbjct:  196 ILREGSSVTIVTFSIQVKLALDAANVLQNDNIDCEVIDLRTIKPLDTDTIIESVKKTNRLVIVEEGWFFAGVGASIASIVMKEAFDYLDAPIEIVSGKDVPLPFAVNLEKLALPSESDVIEAVKKVCYY 324          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_ACHLA (Pyruvate dehydrogenase E1 component subunit beta OS=Acholeplasma laidlawii GN=pdhB PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.155e-17
Identity = 48/123 (39.02%), Postives = 74/123 (60.16%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIK 366
            V+++G+D+T+V WG+ +  +E+A    E EGIS E+IDL+T+ P D+ET+  SV+KTG+ ++  EA  + G  AE+   + E+ F  LEA   R  G D   PL   E ++ P   KI   I+
Sbjct:  198 VVKQGTDMTVVAWGSIVREVEKAVKLVEAEGISVEIIDLRTISPIDEETILNSVKKTGKFMVVTEAVKSYGPAAELITMVNEKAFFHLEAAPVRFTGFDITVPLARGEHYHFPQPEKIAAYIR 320          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_RICPR (Pyruvate dehydrogenase E1 component subunit beta OS=Rickettsia prowazekii GN=pdhB PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 8.793e-17
Identity = 44/129 (34.11%), Postives = 74/129 (57.36%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIKSTVNY 381
            +++EGS++T+V +  Q+ +        + + I CELIDL+T+ P D +++  SV+KT RL+I  E     G GA I++ +++  F  L+AP+  V G D P P     E   MP+ N +++A+K    Y
Sbjct:  196 ILKEGSNVTIVTFSIQVKLALDVVNILQNDNIDCELIDLRTIKPLDTDSIIESVKKTNRLVIVEEGWFFAGVGASIASIVMKEAFDYLDAPIEIVSGKDVPLPYAVNLEKLAMPSANDLIEAVKKVCYY 324          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_RICBR (Pyruvate dehydrogenase E1 component subunit beta OS=Rickettsia bellii (strain RML369-C) GN=pdhB PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.959e-16
Identity = 44/124 (35.48%), Postives = 74/124 (59.68%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIK 366
            V++EG  +T+V +  Q+ +   A    + + I+CE+IDL+T+ P D +T+  SV+KTGRL++  E     G GA I+A +++  F  L+APV  V G D P P     E   +P++  +++A+K
Sbjct:  196 VLKEGDSVTIVTFSIQVKLALDAANILQSDNINCEVIDLRTIKPLDIDTIIESVKKTGRLVVIEEGWFFAGIGATIAAIVMKEAFDYLDAPVEIVSGKDVPLPYAVNLEKLALPSEYDVINAVK 319          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_RICTY (Pyruvate dehydrogenase E1 component subunit beta OS=Rickettsia typhi GN=pdhB PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.558e-16
Identity = 44/129 (34.11%), Postives = 72/129 (55.81%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIKSTVNY 381
            +++EGS++T+V +  Q+ +        + + I CELIDL+T+ P D   +  SV+KT RL+I  E     G GA I++ +++  F  L+AP+  V G D P P     E   MP+ N +++A+K    Y
Sbjct:  196 ILKEGSNVTIVTFSIQVKLALDVVNILQNDNIDCELIDLRTIKPLDTNMIIESVKKTNRLVIVEEGWFFAGVGASIASIVMKEAFDYLDAPIEIVSGKDVPLPYAVNLEKLAMPSANDLIEAVKKVCYY 324          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_RHIME (Pyruvate dehydrogenase E1 component subunit beta OS=Rhizobium meliloti GN=pdhB PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 5.699e-16
Identity = 44/123 (35.77%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIKS 369
            R G D TLV +G  ++   +A  + E +GI  E+IDL+T+ P D  TV  SV+KTGRL+   E       G EI+  ++++ F  L+AP+  + G D P P     E   +P   +++DA+K+
Sbjct:  334 RTGKDATLVSFGIGMTYAIKAAAELEAQGIDVEIIDLRTIRPMDLPTVIESVKKTGRLVTVEEGYPQSSVGTEIATRVMQQAFDYLDAPILTIAGKDVPMPYAANLEKLALPNVAEVVDAVKA 456          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_PEA (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.658e-15
Identity = 48/122 (39.34%), Postives = 67/122 (54.92%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIK 366
            REG D+T+  +   +    +A    EKEGIS E+I+L+++ P D+ T+ ASVRKT RL+   E     G GAEI  S++E  F  L+A V R+ G D P P     E   +P    I+ A K
Sbjct:  225 REGKDVTITAFSKMVGFALKAAEILEKEGISAEVINLRSIRPLDRPTINASVRKTNRLVTVEEGFPQHGVGAEICTSVIEESFGYLDATVERIGGADVPMPYAGNLERLVVPHVEDIVRAAK 346          
The following BLAST results are available for this feature:
BLAST of DC900254 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
ODPB_BACSU1.227e-1838.28Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_DICDI1.356e-1744.66Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_RICCN2.314e-1734.11Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_RICFE3.022e-1734.11Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_ACHLA5.155e-1739.02Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_RICPR8.793e-1734.11Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_RICBR1.959e-1635.48Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_RICTY2.558e-1634.11Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_RHIME5.699e-1635.77Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_PEA1.658e-1539.34Pyruvate dehydrogenase E1 component subunit beta, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900254 VSS Citrus sinensis cDNA clone VS28295 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900254 ID=DC900254|Name=DC900254|organism=Citrus sinensis|type=EST|length=642bp
GTGATTCGAGAAGGCAGTGACATAACACTTGTTGGCTGGGGAGCACAACT
CTCTATCATGGAGCAGGCCTGTTTAGATGCTGAAAAGGAAGGAATTTCTT
GTGAACTGATAGACCTGAAGACACTAATACCATGGGATAAGGAAACAGTA
GAGGCCTCTGTCAGGAAAACCGGACGACTTCTTATTAGCCACGAAGCTCC
GGTTACTGGAGGTTTTGGTGCTGAAATTTCTGCATCTATCCTTGAACGTT
GTTTCTTAAGATTAGAAGCTCCAGTGGCTCGAGTTTGTGGTCTGGACACT
CCCTTCCCTCTCGTTTTCGAACCATTCTACATGCCCACCAAGAATAAGAT
ATTAGATGCAATCAAATCAACTGTAAATTACTAAGAGGGTAACCATCTCT
ACTGCACAACTGCGGATACACAGGTCCAGAGATGAGTGAAATCCCTGCAA
TAGTTTTGCAGGAGGGGAGGTACCAATGTTCCAATACAAACAAACAATAA
GAAAGTTGTATACTCTCCGGAGTTGCTAATTGTTTGTAAACTGGTGGTAA
TGTTATTGGACTGAGCATGCTCACTTACATTCTGCATGTTTGATATGACA
AGTGCAAATGCCATTCTCATCAATGAAGTCCACTCTTTGTTT
back to top