DC900254

Overview
NameDC900254
Unique NameDC900254
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length642
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900254_ssr486 microsatellite DC900254_ssr486:486..497. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1669 contig Csv1_Contig1669:758..1399. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_ARATH (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Arabidopsis thaliana GN=PDH2 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.658e-15
Identity = 48/122 (39.34%), Postives = 68/122 (55.74%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIK 366
            REG D+T+V +   +    +A     +EGIS E+I+L+++ P D+ T+ ASVRKT RL+   E     G  AEI AS++E  F  L+APV R+ G D P P     E   +P    I+ A K
Sbjct:  235 REGKDVTIVTFSKMVGFALKAAEKLAEEGISAEVINLRSIRPLDRATINASVRKTSRLVTVEEGFPQHGVCAEICASVVEESFSYLDAPVERIAGADVPMPYAANLERLALPQIEDIVRASK 356          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_BACSU (2-oxoisovalerate dehydrogenase subunit beta OS=Bacillus subtilis GN=bfmBAB PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.658e-15
Identity = 44/130 (33.85%), Postives = 72/130 (55.38%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLD---TPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            V REG DIT++ +G  +    QA    EK+GIS  ++DL+T+ P DKE +  +  KTG++L+  E    G   +E++A I E C   L+AP+ R+ G D    P+    E ++M   +K+  A++    +
Sbjct:  198 VKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYAPTMEKYFMVNPDKVEAAMRELAEF 327          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ACOB_RALEH (Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acoB PE=1 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 2.166e-15
Identity = 44/127 (34.65%), Postives = 70/127 (55.12%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTV 375
            ++R+G D+++V +G  +    +A     KEGI  E++DL+TL P D +TV  SV  TGRL++  EA        +ISA + ++ F  L+A +  VC   TP P     E  Y+P+  +I  A + T+
Sbjct:  207 IVRDGKDVSIVTYGLMVHRALEAAATLAKEGIEAEIVDLRTLSPLDMDTVLESVENTGRLVVVDEASPRCNIATDISAQVAQQAFGALKAGIEMVCPPHTPVPFSPTLEDLYIPSAAQIAAAARKTM 333          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_PONAB (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Pongo abelii GN=PDHB PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.301e-15
Identity = 50/127 (39.37%), Postives = 69/127 (54.33%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILE-RCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            R+G+ IT+V     +    +A     KEG+ CE+I+++T+ P D ET+EASV KT  L+         G GAEI A I+E   F  L+AP  RV G D P P   + E   +P    I+ AIK T+N
Sbjct:  232 RQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLN 358          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_HUMAN (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens GN=PDHB PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 6.301e-15
Identity = 50/127 (39.37%), Postives = 69/127 (54.33%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILE-RCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            R+G+ IT+V     +    +A     KEG+ CE+I+++T+ P D ET+EASV KT  L+         G GAEI A I+E   F  L+AP  RV G D P P   + E   +P    I+ AIK T+N
Sbjct:  232 RQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLN 358          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_BOVIN (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Bos taurus GN=PDHB PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.404e-14
Identity = 50/127 (39.37%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILE-RCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            R+G+ +T+V     +    +A     KEGI CE+I+L+T+ P D ET+E SV KT  L+         G GAEI A I+E   F  L+AP  RV G D P P   + E   +P    I+ AIK T+N
Sbjct:  232 RQGTHVTIVAHSRPVGHCLEAATVLSKEGIECEVINLRTIRPMDIETIEGSVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSVPQVKDIIFAIKKTLN 358          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_RAT (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Rattus norvegicus GN=Pdhb PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 1.833e-14
Identity = 51/127 (40.16%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILE-RCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            R+G+ IT+V     +    +A     KEGI CE+I+L+T+ P D E +EASV KT  L+         G GAEI A I+E   F  L+AP  RV G D P P   + E   +P    I+ AIK T+N
Sbjct:  232 RQGTHITVVAHSRPVGHCLEAAAVLSKEGIECEVINLRTIRPMDIEAIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLN 358          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_MYCPN (Pyruvate dehydrogenase E1 component subunit beta OS=Mycoplasma pneumoniae GN=pdhB PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.833e-14
Identity = 49/122 (40.16%), Postives = 68/122 (55.74%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKN-KILDAI 363
            +I +G+++T+V +G  +  +       E +    ELIDL+T+ PWDKETV  SV+KTGRLL+  EA  T     EI AS+ E  F  L+A   RV G D   PL     Y    N +IL+A+
Sbjct:  201 LISQGNNLTIVSYGPTMFDLINMVYGGELKDKGIELIDLRTISPWDKETVFNSVKKTGRLLVVTEAAKTFTTSGEIIASVTEELFSYLKAAPQRVTGWDIVVPLARGEHYQFNLNARILEAV 322          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_MOUSE (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Mus musculus GN=Pdhb PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.833e-14
Identity = 51/127 (40.16%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILE-RCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            R+G+ IT+V     +    +A     KEGI CE+I+L+T+ P D E +EASV KT  L+         G GAEI A I+E   F  L+AP  RV G D P P   V E   +P    I+ A+K T+N
Sbjct:  232 RQGTHITVVAHSRPVGHCLEAAAVLSKEGIECEVINLRTIRPMDIEAIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKVLEDNSVPQVKDIIFAVKKTLN 358          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_ZYMMO (Pyruvate dehydrogenase E1 component subunit beta OS=Zymomonas mobilis GN=pdhB PE=3 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.127e-14
Identity = 43/103 (41.75%), Postives = 59/103 (57.28%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFP 309
            +IREG D+T+V +   +S    A     KEGI  E+IDL+TL P DKET+  S+ KT R++   +        +EI+A  +E  F  L+APV RV   DTP P
Sbjct:  333 IIREGKDVTIVSYSIGVSFALTAAEALAKEGIDAEVIDLRTLRPLDKETILQSLAKTNRIVTVEDGWPVCSISSEIAAIAMEEGFDNLDAPVLRVTNADTPTP 435          
The following BLAST results are available for this feature:
BLAST of DC900254 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
ODPB_ARATH1.658e-1539.34Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODBB_BACSU1.658e-1533.852-oxoisovalerate dehydrogenase subunit beta OS=Bac... [more]
ACOB_RALEH2.166e-1534.65Acetoin:2,6-dichlorophenolindophenol oxidoreductas... [more]
ODPB_PONAB6.301e-1539.37Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_HUMAN6.301e-1539.37Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_BOVIN1.404e-1439.37Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_RAT1.833e-1440.16Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_MYCPN1.833e-1440.16Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_MOUSE1.833e-1440.16Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_ZYMMO3.127e-1441.75Pyruvate dehydrogenase E1 component subunit beta O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900254 VSS Citrus sinensis cDNA clone VS28295 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900254 ID=DC900254|Name=DC900254|organism=Citrus sinensis|type=EST|length=642bp
GTGATTCGAGAAGGCAGTGACATAACACTTGTTGGCTGGGGAGCACAACT
CTCTATCATGGAGCAGGCCTGTTTAGATGCTGAAAAGGAAGGAATTTCTT
GTGAACTGATAGACCTGAAGACACTAATACCATGGGATAAGGAAACAGTA
GAGGCCTCTGTCAGGAAAACCGGACGACTTCTTATTAGCCACGAAGCTCC
GGTTACTGGAGGTTTTGGTGCTGAAATTTCTGCATCTATCCTTGAACGTT
GTTTCTTAAGATTAGAAGCTCCAGTGGCTCGAGTTTGTGGTCTGGACACT
CCCTTCCCTCTCGTTTTCGAACCATTCTACATGCCCACCAAGAATAAGAT
ATTAGATGCAATCAAATCAACTGTAAATTACTAAGAGGGTAACCATCTCT
ACTGCACAACTGCGGATACACAGGTCCAGAGATGAGTGAAATCCCTGCAA
TAGTTTTGCAGGAGGGGAGGTACCAATGTTCCAATACAAACAAACAATAA
GAAAGTTGTATACTCTCCGGAGTTGCTAATTGTTTGTAAACTGGTGGTAA
TGTTATTGGACTGAGCATGCTCACTTACATTCTGCATGTTTGATATGACA
AGTGCAAATGCCATTCTCATCAATGAAGTCCACTCTTTGTTT
back to top