DC900034

Overview
NameDC900034
Unique NameDC900034
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length481
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5632 contig Csv1_Contig5632:1..481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB1_BOVIN (Voltage-gated potassium channel subunit beta-1 OS=Bos taurus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.810e-13
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  173 NKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 412
            NK+  L PIA+ LG  L QLA+AWC  N  VSSV+ G++   Q+ EN+ AI V+P +T  V+++I+  + +KP   + YR
Sbjct:  321 NKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYR 400          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB2_XENLA (Voltage-gated potassium channel subunit beta-2 OS=Xenopus laevis GN=kcnab2 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.414e-12
Identity = 38/100 (38.00%), Postives = 56/100 (56.00%), Query Frame = -1
Query:  173 GFAWKNYKNLANRSLVDDVLNKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 472
            G+ W   K L+          K+   + IA+ LG  L QLAIAWC  N  VSSV+ GA+   Q+ EN+ AI V+P L+ S++ +I+  + +KP   + YR
Sbjct:  269 GYQWLKDKILSEEGRRQQA--KLKEFQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLLENIGAIQVLPKLSSSIIHEIDGILGNKPYSKKDYR 366          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB1_CHICK (Voltage-gated potassium channel subunit beta-1 OS=Gallus gallus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.765e-12
Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = -1
Query:  173 KVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 409
            K+  L PIA+ LG  L QLA+AWC  N  VSSV+ G++   Q+ EN+ AI V+P +T  ++++I+  + +KP   + YR
Sbjct:  322 KLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSNPEQLIENLGAIQVLPKMTSHIVNEIDNILGNKPYSKKDYR 400          
BLAST of DC900034 vs. ExPASy Swiss-Prot
Match: KCAB3_XENLA (Voltage-gated potassium channel subunit beta-3 OS=Xenopus laevis GN=kcnab3 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.677e-11
Identity = 37/100 (37.00%), Postives = 55/100 (55.00%), Query Frame = -1
Query:  173 GFAWKNYKNLANRSLVDDVLNKVNRLKPIADELGVPLAQLAIAWCASNPNVSSVITGATKESQIQENMKAIDVIPLLTPSVMDKIEAAVLSKPKRPESYR 472
            G+ W   K ++         +KV  L PIAD L   + QLAIAWC  +  VSSV+ G +   Q+ EN+ AI V+P LTP ++ +I+  + +KP   +  R
Sbjct:  303 GYHWLKEKAISQEGKKQH--SKVKELHPIADRLNCTVTQLAIAWCLRSEGVSSVLLGVSNIEQLLENLGAIQVLPHLTPQLVTEIDQILGNKPNLKKDSR 400          
The following BLAST results are available for this feature:
BLAST of DC900034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
KCAB1_BOVIN6.810e-1343.75Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB2_XENLA4.414e-1238.00Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB1_CHICK5.765e-1241.77Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB3_XENLA1.677e-1137.00Voltage-gated potassium channel subunit beta-3 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900034 VSS Citrus sinensis cDNA clone VS27Q42 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900034 ID=DC900034|Name=DC900034|organism=Citrus sinensis|type=EST|length=481bp
TCATTTTCTTTTACAAGAAAATATATCATATCTGAGAGTCTCTGAAGTAC
AGAGCTAAGAAACAATAACTAAAACATCAGACAAGCATAGTAACAACATG
AATACACTGAAGCAGCTAGGTATGTCGCACGCAGCAGAAGATGGAAATGA
GCTAATAAATAATCTCCGCCTACCGATACGACTCCGGACGCTTTGGCTTG
CTTAGAACAGCAGCCTCAATCTTGTCCATCACTGACGGAGTCAGCAGTGG
AATGACATCAATGGCTTTCATGTTCTCTTGAATCTGGGATTCCTTTGTGG
CACCAGTTATAACTGAAGATACATTAGGATTTGAAGCACACCATGCAATT
GCAAGTTGAGCTAAAGGCACGCCTAGTTCATCTGCAATTGGCTTCAGTCG
ATTAACTTTATTCAGCACATCATCGACCAGTGATCGGTTAGCAAGATTCT
TGTAATTTTTCCAAGCAAACCCGACTGTCAG
back to top