CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX5_MOUSE (Epididymal secretory glutathione peroxidase OS=Mus musculus GN=Gpx5 PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.122e-12
Identity = 50/137 (36.50%), Postives = 65/137 (47.45%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDN-EQIQEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLK---------------SSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y EL+ L +  K  GL IL FPCNQFG QEPGDN E +      R    F   F +F K DVNG+N   ++  LK               +S   +    I+WNF KFLV  +G  V R+       +++ DI   L
Sbjct:   79 YPELNALQEDLKPFGLVILGFPCNQFGKQEPGDNLEILPGLKYVRPGKGFLPNFQLFAKGDVNGENEQKIFTFLKRSCPHPSETVVMSKHTSWEPIKVHDIRWNFEKFLVGPDGVPVMRWFHQAPVSTVKSDIMAYL 215          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_CALJA (Glutathione peroxidase 2 OS=Callithrix jacchus GN=GPX2 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 1.466e-12
Identity = 46/145 (31.72%), Postives = 70/145 (48.28%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  ++T+L++L  ++  + L +L FPC+QFG QE   NE+I       R    ++  F +  K +VNG N  P++ +LK        D                    + WNF KFL+  EG    RY+ T   ++IE DIK+LL
Sbjct:   43 TTRDFTQLNELQCRFPRR-LVVLGFPCHQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPHDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLL 186          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_MACFU (Glutathione peroxidase 2 OS=Macaca fuscata fuscata GN=GPX2 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 3.265e-12
Identity = 46/146 (31.51%), Postives = 70/146 (47.95%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            T  ++T+L++L  ++  + L +L FPCNQFG QE   NE+I       R    ++  F +  K +VNG N  P++ +LK        D                    + WNF KFL+  E     RY+ T   ++IE DIK+LL+
Sbjct:   43 TTRDFTQLNELQCRFPRR-LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPHDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEVEPFRRYSRTFPTINIEPDIKRLLK 187          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX5_CANFA (Epididymal secretory glutathione peroxidase OS=Canis familiaris GN=GPX5 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.570e-12
Identity = 46/135 (34.07%), Postives = 67/135 (49.63%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFGD------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            + Y EL+ L ++ K  GL +L FPCNQFG Q PG+N +I       R    +   F +F+K DVNG+    ++  LK S      + G              I+WNF KFLV  +G  V R+   T   ++++DI
Sbjct:   77 AQYPELNSLQEELKPLGLVVLGFPCNQFGKQGPGENSEILPGLKYVRPGRGYVPNFQLFEKGDVNGEKEQKVFTFLKLSCPHPSEVLGSFRHISWDPVKVHDIRWNFEKFLVGPDGVPVLRWFHRTPISTVKEDI 211          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPXC_DIRIM (Glutathione peroxidase OS=Dirofilaria immitis PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.501e-12
Identity = 44/125 (35.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQ-------IQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKS---SKGGLFGD------------SIKWNFSKFLVDKEGNVVERYAPT 322
            Y + + + +   N  L+ILAFPCNQF  QEP +N +       ++            IF KV+VNGD+  PLYK LK        + GD             I WNF KFL+DK+G+   R+ P+
Sbjct:   78 YNDFNPMLENNSNGTLKILAFPCNQFLLQEPAENHELLNGLKYVRPGNGWEPHGNMHIFGKVEVNGDDHHPLYKFLKEHCPQTVPIIGDRHQLMYNPIGTNDIIWNFEKFLIDKKGHPRYRFHPS 202          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
GPX5_MOUSE1.122e-1236.50Epididymal secretory glutathione peroxidase OS=Mus... [more]
GPX2_CALJA1.466e-1231.72Glutathione peroxidase 2 OS=Callithrix jacchus GN=... [more]
GPX2_MACFU3.265e-1231.51Glutathione peroxidase 2 OS=Macaca fuscata fuscata... [more]
GPX5_CANFA5.570e-1234.07Epididymal secretory glutathione peroxidase OS=Can... [more]
GPXC_DIRIM9.501e-1235.20Glutathione peroxidase OS=Dirofilaria immitis PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top