CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX41_MOUSE (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial OS=Mus musculus GN=Gpx4 PE=1 SV=4)

HSP 1 Score: 129.413 bits (324), Expect = 5.923e-30
Identity = 64/119 (53.78%), Postives = 86/119 (72.27%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLK-SSKG-GLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            T+ NYT+L  L+ +Y   GL ILAFPCNQFG QEPG N++I+EFA   +  +F ++ K+ VNGD+A PL+K +K   KG G+ G++IKWNF+KFL+DK G VV+RY P   P  IEKD+
Sbjct:   76 TDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA-AGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDL 193          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX42_RAT (Phospholipid hydroperoxide glutathione peroxidase, nuclear OS=Rattus norvegicus GN=Gpx4 PE=2 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 7.736e-30
Identity = 64/119 (53.78%), Postives = 85/119 (71.43%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLK-SSKG-GLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            T+ NYT+L  L+ +Y   GL ILAFPCNQFG QEPG N++I+EFA   +   F ++ K+ VNGD+A PL+K +K   KG G+ G++IKWNF+KFL+DK G VV+RY P   P  IEKD+
Sbjct:  132 TDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA-AGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDL 249          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX41_RAT (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial OS=Rattus norvegicus GN=Gpx4 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 7.736e-30
Identity = 64/119 (53.78%), Postives = 85/119 (71.43%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLK-SSKG-GLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            T+ NYT+L  L+ +Y   GL ILAFPCNQFG QEPG N++I+EFA   +   F ++ K+ VNGD+A PL+K +K   KG G+ G++IKWNF+KFL+DK G VV+RY P   P  IEKD+
Sbjct:   76 TDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA-AGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDL 193          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_PIG (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial OS=Sus scrofa GN=GPX4 PE=1 SV=3)

HSP 1 Score: 127.102 bits (318), Expect = 2.940e-29
Identity = 64/119 (53.78%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLK-SSKG-GLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            T  NYT+L  L+ +Y   GL ILAFPCNQFG QEPG + +I+EFA   +  +F +F K+ VNGD+A PL+K +K   KG G+ G++IKWNF+KFL+DK G VV+RY P   P  IEKD+
Sbjct:   76 TEVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSDAEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDL 193          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_SCHPO (Glutathione peroxidase OS=Schizosaccharomyces pombe GN=gpx1 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.839e-29
Identity = 58/117 (49.57%), Postives = 79/117 (67.52%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y  L  LY KYK++G  IL FPCNQFG QEPG +E+I +F    +   FP+  K++VNGDN  P+Y+ LKS K  L  + IKWNF KFLV+++G V+ERY+  + P  +E DI+ +L
Sbjct:   42 YKGLEALYQKYKDRGFIILGFPCNQFGNQEPGSDEEIAQFCQKNYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGLERIKWNFEKFLVNRQGQVIERYSSISKPEHLENDIESVL 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX42_MOUSE (Phospholipid hydroperoxide glutathione peroxidase, nuclear OS=Mus musculus GN=Gpx4 PE=2 SV=3)

HSP 1 Score: 125.946 bits (315), Expect = 6.549e-29
Identity = 62/119 (52.10%), Postives = 85/119 (71.43%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLK-SSKG-GLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            T+ NYT+L  L+ +Y   GL ILAFPCNQFG QEPG N++I+EFA   +  +F ++ K+ VNGD+A PL+K +K   KG G+ G++IKWNF+KFL+DK G  V+RY P   P  IE+D+
Sbjct:  132 TDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA-AGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCEVKRYGPMEEPQVIERDL 249          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAES (Glutathione peroxidase homolog bsaA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=bsaA PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 8.553e-29
Identity = 56/114 (49.12%), Postives = 78/114 (68.42%), Query Frame = 2
Query:   23 LSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            L +LYD+YK+Q   IL FPCNQFG QEPG  E+  +     +   FPI +KVDV GDN  PL+  L ++  G+  + IKWNF+KFL+D+EGNV++R++P   P  I+ +I+KLL
Sbjct:   45 LQKLYDEYKDQRFIILGFPCNQFGGQEPGSGEEAAQNCKINYGVTFPIHEKVDVKGDNQHPLFHFLTNAAKGMINEKIKWNFTKFLIDREGNVIKRFSPQKKPEQIKTEIEKLL 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAEQ (Glutathione peroxidase homolog bsaA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=bsaA PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 7.241e-28
Identity = 58/121 (47.93%), Postives = 80/121 (66.12%), Query Frame = 2
Query:    5 NSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            N  + +L  LY KY   GLEIL+FPCN F  QEPG  + I      +F   FPI  K++VNG++  PLY  LK  + GLFG  IKWNF+KF+VD++GN+V+R+ P  +P  +EK I++LL+
Sbjct:   38 NDQFNKLEMLYKKYHKYGLEILSFPCNDFNNQEPGLIKDIYRVYKYKFGITFPIHAKINVNGEHEHPLYTLLKCKQPGLFGSQIKWNFTKFVVDQQGNIVKRFLPCDNPNQMEKLIRQLLK 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPO_SYNY3 (Putative glutathione peroxidase OS=Synechocystis sp. (strain PCC 6803) GN=slr1171 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 9.457e-28
Identity = 58/123 (47.15%), Postives = 81/123 (65.85%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLF------GDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y  L  LY+++ ++G  +L FPCNQFG QEPG + +I+ F  TR+   FP+F+KV+VNG NA PL+K L ++  G+        + IKWNF+KFLVD++G VV+RY     P  I  DI+KLL
Sbjct:   47 YQGLQALYNRFGDRGFTVLGFPCNQFGQQEPGGSGEIKNFCETRYGVTFPLFEKVEVNGPNAHPLFKFLTAASPGMAIPFLGGAEDIKWNFTKFLVDRQGKVVKRYGSIAKPDEIAADIEKLL 169          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_CHLRE (Glutathione peroxidase 1, mitochondrial OS=Chlamydomonas reinhardtii GN=GPX PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 3.973e-26
Identity = 64/125 (51.20%), Postives = 78/125 (62.40%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTR--FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLET 370
            T +NY E + L  KY    L I+AFPCNQFG QEPG N +I+ FA  R    A   + DKVDVNG NA+P+Y  LK + G      I WNF KFLV  +G V  RYAPTT PLS+EK I +L+ +
Sbjct:   78 TAANYKEFATLLGKYPATDLTIVAFPCNQFGGQEPGTNAEIKAFASARGFSGAGALLMDKVDVNGANASPVYNFLKVAAGDT--SDIGWNFGKFLVRPDGTVFGRYAPTTGPLSLEKYIVELINS 200          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
GPX41_MOUSE5.923e-3053.78Phospholipid hydroperoxide glutathione peroxidase,... [more]
GPX42_RAT7.736e-3053.78Phospholipid hydroperoxide glutathione peroxidase,... [more]
GPX41_RAT7.736e-3053.78Phospholipid hydroperoxide glutathione peroxidase,... [more]
GPX4_PIG2.940e-2953.78Phospholipid hydroperoxide glutathione peroxidase,... [more]
GPX1_SCHPO3.839e-2949.57Glutathione peroxidase OS=Schizosaccharomyces pomb... [more]
GPX42_MOUSE6.549e-2952.10Phospholipid hydroperoxide glutathione peroxidase,... [more]
BSAA_STAES8.553e-2949.12Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]
BSAA_STAEQ7.241e-2847.93Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]
GPO_SYNY39.457e-2847.15Putative glutathione peroxidase OS=Synechocystis s... [more]
GPX1_CHLRE3.973e-2651.20Glutathione peroxidase 1, mitochondrial OS=Chlamyd... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top