CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPXA_NEIMF (Glutathione peroxidase homolog OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=gpxA PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.189e-26
Identity = 63/137 (45.99%), Postives = 82/137 (59.85%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSK-----GGLFGD---------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y  L +LY +Y  +GLEIL FPCNQF  Q P  + +I +    +F  +F IFDK++VNG N APLY +LKS K       LF D                IKWNF+KFLV+++G VVER+AP+ +P  IE DI+ LL
Sbjct:   41 YEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL 177          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPXA_NEIMC (Glutathione peroxidase homolog OS=Neisseria meningitidis serogroup C GN=gpxA PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.189e-26
Identity = 63/137 (45.99%), Postives = 82/137 (59.85%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSK-----GGLFGD---------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y  L +LY +Y  +GLEIL FPCNQF  Q P  + +I +    +F  +F IFDK++VNG N APLY +LKS K       LF D                IKWNF+KFLV+++G VVER+AP+ +P  IE DI+ LL
Sbjct:   41 YEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL 177          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPXA_NEIMB (Glutathione peroxidase homolog OS=Neisseria meningitidis serogroup B GN=gpxA PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.189e-26
Identity = 63/137 (45.99%), Postives = 82/137 (59.85%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSK-----GGLFGD---------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y  L +LY +Y  +GLEIL FPCNQF  Q P  + +I +    +F  +F IFDK++VNG N APLY +LKS K       LF D                IKWNF+KFLV+++G VVER+AP+ +P  IE DI+ LL
Sbjct:   41 YEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL 177          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPXA_NEIMA (Glutathione peroxidase homolog OS=Neisseria meningitidis serogroup A GN=gpxA PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.189e-26
Identity = 63/137 (45.99%), Postives = 82/137 (59.85%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSK-----GGLFGD---------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y  L +LY +Y  +GLEIL FPCNQF  Q P  + +I +    +F  +F IFDK++VNG N APLY +LKS K       LF D                IKWNF+KFLV+++G VVER+AP+ +P  IE DI+ LL
Sbjct:   41 YEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL 177          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_YEAST (Glutathione peroxidase 1 OS=Saccharomyces cerevisiae GN=GPX1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.413e-23
Identity = 55/118 (46.61%), Postives = 75/118 (63.56%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFG-DSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y EL  LY+KYK+ GL I+AFPC QFG QE   +++I +F   ++   FPI  K+  NG    P+YK LK+S  G  G   IKWNF KF+VD+ G VV+R++  T PL +   I++LL
Sbjct:   42 YKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELL 159          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX_ENCCU (Probable phospholipid hydroperoxide glutathione peroxidase OS=Encephalitozoon cuniculi GN=ECU02_0440 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.947e-21
Identity = 50/122 (40.98%), Postives = 77/122 (63.11%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKG--GLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            SNY   + L DK+  +GL IL FPCNQ+  QE    E+I+     ++   F +FDKVDV G  A P+++HL ++K   G  G+ IKWNF+KFLVD++G VV+R+ P+      ++++ + +E
Sbjct:   47 SNYKSFAGLLDKFYRKGLRILLFPCNQYLGQESRPIEEIRGEVSKKYSDRFVVFDKVDVFGKGAHPVFRHLVNTKNGKGRLGNFIKWNFTKFLVDRKGCVVKRFGPSDIVKEDDENLLRSIE 168          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BTUE_ECOLI (Vitamin B12 transport periplasmic protein btuE OS=Escherichia coli (strain K12) GN=btuE PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 8.024e-19
Identity = 43/126 (34.13%), Postives = 68/126 (53.97%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHL--------------------KSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSP 331
            Y +L  +   + ++G  +L FPCNQF  QEPG +E+I+ +  T +   FP+F K++VNG+   PLY+ L                       +  L+ D I WNF KFLV ++G V++R++P  +P
Sbjct:   43 YEQLENIQKAWVDRGFMVLGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVAPEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTP 168          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX8B_XENLA (Probable glutathione peroxidase 8-B OS=Xenopus laevis GN=gpx8-B PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.335e-18
Identity = 44/121 (36.36%), Postives = 67/121 (55.37%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T +NY  L +L+ ++      +LAFPCNQFG  EPG N++I+  A   +   FP+F K+ + G  A P Y+ L  S         +WNF K+LVD +G VV+ + P  +  SI  ++  L+
Sbjct:   82 TEANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNKEIEAMAKRNYGVTFPVFSKIKILGSEAEPAYRFLVDST----KKEPRWNFWKYLVDPQGQVVKYWRPDETAESIRPEVASLV 198          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX7_MOUSE (Glutathione peroxidase 7 OS=Mus musculus GN=Gpx7 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.982e-18
Identity = 47/117 (40.17%), Postives = 61/117 (52.14%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            T+ NY  L QL          +LAFPCNQFG QEP  N +I+ FA   +   FP+F K+ V G  A P +K+L  +     G    WNF K+LVD +G VV  + PT     I+  I
Sbjct:   59 TDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTS----GKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRI 171          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX7_HUMAN (Glutathione peroxidase 7 OS=Homo sapiens GN=GPX7 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.513e-17
Identity = 46/121 (38.02%), Postives = 63/121 (52.07%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T+ +Y  L QL          +LAFPCNQFG QEP  N++I+ FA   +   FP+F K+ V G  A P +K+L  +     G    WNF K+LV  +G VV  + PT S   +   I  L+
Sbjct:   60 TDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTS----GKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALV 176          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
GPXA_NEIMF5.189e-2645.99Glutathione peroxidase homolog OS=Neisseria mening... [more]
GPXA_NEIMC5.189e-2645.99Glutathione peroxidase homolog OS=Neisseria mening... [more]
GPXA_NEIMB5.189e-2645.99Glutathione peroxidase homolog OS=Neisseria mening... [more]
GPXA_NEIMA5.189e-2645.99Glutathione peroxidase homolog OS=Neisseria mening... [more]
GPX1_YEAST1.413e-2346.61Glutathione peroxidase 1 OS=Saccharomyces cerevisi... [more]
GPX_ENCCU2.947e-2140.98Probable phospholipid hydroperoxide glutathione pe... [more]
BTUE_ECOLI8.024e-1934.13Vitamin B12 transport periplasmic protein btuE OS=... [more]
GPX8B_XENLA2.335e-1836.36Probable glutathione peroxidase 8-B OS=Xenopus lae... [more]
GPX7_MOUSE3.982e-1840.17Glutathione peroxidase 7 OS=Mus musculus GN=Gpx7 P... [more]
GPX7_HUMAN1.513e-1738.02Glutathione peroxidase 7 OS=Homo sapiens GN=GPX7 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top