CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX8_DANRE (Probable glutathione peroxidase 8 OS=Danio rerio GN=gpx8 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 9.181e-15
Identity = 41/121 (33.88%), Postives = 63/121 (52.07%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +Y  L +L+ +       +LAFPC+Q+G  E G + +I+ FA + +   FPIF+K+ + G  A P ++ L  S   +     +WNF KFLV  EG VV  + P      I K+   L+
Sbjct:   83 TEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTSREIEAFAKSNYGVTFPIFNKIKIMGSEAEPAFRFLTDSVQKI----PRWNFWKFLVSPEGQVVRFWKPEEPVSDIRKEATTLV 199          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX5_MACFA (Epididymal secretory glutathione peroxidase OS=Macaca fascicularis GN=GPX5 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.045e-14
Identity = 50/140 (35.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFG------------DSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            + Y EL+ L ++ K  GL +L FPCNQFG QEPGDN++I       R    F   F +F+K DVNG+    ++  LK S      + G              I+WNF KFLV  +G  V R++   +  S++ DI   L+
Sbjct:   77 AQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPNFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLK 216          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX5_HUMAN (Epididymal secretory glutathione peroxidase OS=Homo sapiens GN=GPX5 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.045e-14
Identity = 50/140 (35.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFG------------DSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            + Y EL+ L ++ K  GL +L FPCNQFG QEPGDN++I       R    F   F +F+K DVNG+    ++  LK S      + G              I+WNF KFLV  +G  V R++   +  S++ DI   L+
Sbjct:   77 AQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLK 216          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_MACFU (Glutathione peroxidase 1 OS=Macaca fuscata fuscata GN=GPX1 PE=2 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 2.671e-14
Identity = 49/145 (33.79%), Postives = 71/145 (48.97%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDS-------------------IKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +YT++++L  +   +GL +L FPCNQFG QE   NE+I       R    F+  F +F+K +VNG  A PL+  L+ +      D+                   + WNF KFLV  +G  V RY+     + IE DI+ LL
Sbjct:   50 TVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLIAWSPVCRNDVAWNFEKFLVGPDGVPVRRYSRRFQTIDIEPDIEALL 194          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX6_RAT (Glutathione peroxidase 6 OS=Rattus norvegicus GN=Gpx6 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.489e-14
Identity = 51/139 (36.69%), Postives = 69/139 (49.64%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKS----------SKGGLFGD-----SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            + Y EL+ L ++ +   + +L FPCNQFG QEPG N +I       R    F   F +F+K DVNGDN   ++  LKS          S   LF D      I+WNF KFLV  +G  V R+   T    ++ DI + L
Sbjct:   77 ATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYL 215          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX3_RAT (Glutathione peroxidase 3 OS=Rattus norvegicus GN=Gpx3 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.489e-14
Identity = 50/133 (37.59%), Postives = 68/133 (51.13%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKS----------SKGGLFGD-----SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            Y EL+ L ++    GL IL FPCNQFG QEPG+N +I       R    F   F +F+K DVNG+     Y  LK+          S G LF +      I+WNF KFLV  +G  + R+   T+  +++ DI
Sbjct:   79 YLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPIMRWYHRTTVSNVKMDI 211          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX3_HYLLA (Glutathione peroxidase 3 OS=Hylobates lar GN=GPX3 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.489e-14
Identity = 50/133 (37.59%), Postives = 67/133 (50.38%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFGDS------------IKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            Y EL+ L ++    GL IL FPCNQFG QEPG+N +I       R    F   F +F+K DVNG+     Y  LK+S      L G S            I+WNF KFLV  +G  + R+   T+  +++ DI
Sbjct:   79 YIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGTPIMRWHHRTTVSNVKMDI 211          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX3_CEBAP (Glutathione peroxidase 3 OS=Cebus apella GN=GPX3 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.489e-14
Identity = 50/133 (37.59%), Postives = 68/133 (51.13%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFGDS------------IKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            Y EL+ L ++    GL++L FPCNQFG QEPG+N +I       R    F   F +F+K DVNG+     Y  LK+S      L G S            I+WNF KFLV  +G  V R+   T+  +++ DI
Sbjct:   79 YIELNALQEELAPFGLDLLGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPVMRWHHRTTISNVKMDI 211          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX3_BOVIN (Glutathione peroxidase 3 OS=Bos taurus GN=GPX3 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.489e-14
Identity = 50/135 (37.04%), Postives = 68/135 (50.37%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTR-------FKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFGD------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            Y EL+ L ++ +  GL IL FPCNQFG QEPG+N +I   A  +       F   F +F+K DVNG+     Y  LK+S      L G              I+WNF KFLV  +G  + R+   T+  S++ DI
Sbjct:   79 YVELNALQEELEPFGLVILGFPCNQFGKQEPGENSEI--LATLKYVRPGGGFTPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWYHRTTVNSVKMDI 211          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_BOVIN (Glutathione peroxidase 1 OS=Bos taurus GN=GPX1 PE=1 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 3.489e-14
Identity = 48/147 (32.65%), Postives = 72/147 (48.98%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTR-------FKAEFPIFDKVDVNGDNAAPLYKHLKS-------------------SKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +YT+++ L  +   +GL +L FPCNQFG QE   NE+I    C +       F+  F +F+K +VNG+ A PL+  L+                    +   +  + + WNF KFLV  +G  V RY+     + IE DI+ LL
Sbjct:   55 TVRDYTQMNDLQRRLGPRGLVVLGFPCNQFGHQENAKNEEI--LNCLKYVRPGGGFEPNFMLFEKCEVNGEKAHPLFAFLREVLPTPSDDATALMTDPKFITWSPVCRNDVSWNFEKFLVGPDGVPVRRYSRRFLTIDIEPDIETLL 199          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
GPX8_DANRE9.181e-1533.88Probable glutathione peroxidase 8 OS=Danio rerio G... [more]
GPX5_MACFA2.045e-1435.71Epididymal secretory glutathione peroxidase OS=Mac... [more]
GPX5_HUMAN2.045e-1435.71Epididymal secretory glutathione peroxidase OS=Hom... [more]
GPX1_MACFU2.671e-1433.79Glutathione peroxidase 1 OS=Macaca fuscata fuscata... [more]
GPX6_RAT3.489e-1436.69Glutathione peroxidase 6 OS=Rattus norvegicus GN=G... [more]
GPX3_RAT3.489e-1437.59Glutathione peroxidase 3 OS=Rattus norvegicus GN=G... [more]
GPX3_HYLLA3.489e-1437.59Glutathione peroxidase 3 OS=Hylobates lar GN=GPX3 ... [more]
GPX3_CEBAP3.489e-1437.59Glutathione peroxidase 3 OS=Cebus apella GN=GPX3 P... [more]
GPX3_BOVIN3.489e-1437.04Glutathione peroxidase 3 OS=Bos taurus GN=GPX3 PE=... [more]
GPX1_BOVIN3.489e-1432.65Glutathione peroxidase 1 OS=Bos taurus GN=GPX1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top