CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_MOUSE (Glutathione peroxidase 2 OS=Mus musculus GN=Gpx2 PE=2 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 1.015e-13
Identity = 47/146 (32.19%), Postives = 71/146 (48.63%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            T  +Y +L++L  ++  + L +L FPCNQFG QE   NE+I       R    ++  F +  K DVNG N  P++ +LK      + D                    + WNF KFL+  EG    RY+ +   ++IE DIK+LL+
Sbjct:   43 TTRDYNQLNELQCRFPRR-LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFSLTQKCDVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINIEPDIKRLLK 187          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_HYLLA (Glutathione peroxidase 2 OS=Hylobates lar GN=GPX2 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 1.015e-13
Identity = 47/146 (32.19%), Postives = 72/146 (49.32%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            T  ++T+L++L  ++  + L +L FPCNQFG QE   NE+I       R    ++  F +  K +VNG N  P++ +LK      + D                    + WNF KFL+  EG    RY+ T   ++IE DIK+LL+
Sbjct:   43 TTRDFTQLNELQCRFPRR-LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLK 187          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_HUMAN (Glutathione peroxidase 2 OS=Homo sapiens GN=GPX2 PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 1.015e-13
Identity = 47/146 (32.19%), Postives = 72/146 (49.32%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            T  ++T+L++L  ++  + L +L FPCNQFG QE   NE+I       R    ++  F +  K +VNG N  P++ +LK      + D                    + WNF KFL+  EG    RY+ T   ++IE DIK+LL+
Sbjct:   43 TTRDFTQLNELQCRFPRR-LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLK 187          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_PIG (Glutathione peroxidase 1 OS=Sus scrofa GN=GPX1 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 1.015e-13
Identity = 49/147 (33.33%), Postives = 72/147 (48.98%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTR-------FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDS-------------------IKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +YT++++L  +   +GL +L FPCNQFG QE   N +I    C +       F+  F +F+K +VNG NA PL+  L+ +      D+                   I WNF KFLV  +G  + RY+     + IE DI+ LL
Sbjct:   55 TVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNGEI--LNCLKYVRPGGGFEPNFMLFEKCEVNGANAHPLFAFLREALPTPSDDATALMTDPKFITWSPVCRNDIAWNFEKFLVGPDGVPLRRYSRRFLTIDIEPDIEALL 199          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX5_PIG (Epididymal secretory glutathione peroxidase OS=Sus scrofa GN=GPX5 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.953e-13
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFGD------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            + Y EL+ L ++ K  GL +L FPCNQFG QEPG+N +I       R    +   F +F+K DVNG+    ++  LK S      L G              I+WNF KFLV  +G  V R+   T   +++ DI   L+
Sbjct:   75 AQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLK 214          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_CEBAP (Glutathione peroxidase 2 OS=Cebus apella GN=GPX2 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 2.953e-13
Identity = 47/146 (32.19%), Postives = 71/146 (48.63%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            T  ++T+L++L  ++  + L +L FPCNQFG QE   NE+I       R    ++  F +  K +VNG N  P++ +LK        D                    + WNF KFL+  EG    RY+ T   ++IE DIK+LL+
Sbjct:   43 TTRDFTQLNELQCRFPRR-LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPHDDPFSLMTDPKFIIWSPVCRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLK 187          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_RABIT (Glutathione peroxidase 1 OS=Oryctolagus cuniculus GN=GPX1 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 2.953e-13
Identity = 47/145 (32.41%), Postives = 70/145 (48.28%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +YT++++L ++   + L +L FPCNQFG QE   NE+I       R    F+  F +F K +VNG  A+PL+  L+ +      D                    + W+F KFLV  +G  V RY+     + IE DI+ LL
Sbjct:   49 TVRDYTQMNELQERLGPRALVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFQKCEVNGAKASPLFAFLREALPPPSDDPTALMTDPKFITWCPVCRNDVSWSFEKFLVGPDGVPVRRYSRRFPTIDIEPDIQALL 193          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX3_MOUSE (Glutathione peroxidase 3 OS=Mus musculus GN=Gpx3 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 3.857e-13
Identity = 50/133 (37.59%), Postives = 67/133 (50.38%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKS----------SKGGLFGD-----SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            Y EL+ L ++    GL IL FP NQFG QEPG+N +I       R    F   F +F+K DVNG+     Y  LK+          S G LF +      I+WNF KFLV  +G  V R+   T+  +++ DI
Sbjct:   79 YLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMDI 211          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_PANTR (Glutathione peroxidase 1 OS=Pan troglodytes GN=GPX1 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 5.038e-13
Identity = 47/145 (32.41%), Postives = 70/145 (48.28%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDS-------------------IKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +YT++++L  +   +GL +L FPCNQFG QE   NE+I       R    F+  F +F+K +VNG  A  L+  L+ +      D+                   + WNF KFLV  +G  + RY+     + IE DI+ LL
Sbjct:   50 TVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHTLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALL 194          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX5_RAT (Epididymal secretory glutathione peroxidase OS=Rattus norvegicus GN=Gpx5 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.122e-12
Identity = 51/133 (38.35%), Postives = 62/133 (46.62%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSS----------KGGLFGDSIK-----WNFSKFLVDKEGNVVERYAPTTSPLSIEKDI 352
            Y EL+ L D  K  GL IL FPCNQFG QEPGDN +I       R    F   F +F K DVNG+    ++  LK S              F + IK     WNF KFLV   G  V R+       +++ DI
Sbjct:   79 YPELNALQDDLKQFGLVILGFPCNQFGKQEPGDNTEILPGLKYVRPGKGFLPNFQLFAKGDVNGEKEQEIFTFLKRSCPHPSETVVTSKHTFWEPIKVHDIRWNFEKFLVGPNGVPVMRWFHQAPVSTVKSDI 211          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
GPX2_MOUSE1.015e-1332.19Glutathione peroxidase 2 OS=Mus musculus GN=Gpx2 P... [more]
GPX2_HYLLA1.015e-1332.19Glutathione peroxidase 2 OS=Hylobates lar GN=GPX2 ... [more]
GPX2_HUMAN1.015e-1332.19Glutathione peroxidase 2 OS=Homo sapiens GN=GPX2 P... [more]
GPX1_PIG1.015e-1333.33Glutathione peroxidase 1 OS=Sus scrofa GN=GPX1 PE=... [more]
GPX5_PIG2.953e-1335.00Epididymal secretory glutathione peroxidase OS=Sus... [more]
GPX2_CEBAP2.953e-1332.19Glutathione peroxidase 2 OS=Cebus apella GN=GPX2 P... [more]
GPX1_RABIT2.953e-1332.41Glutathione peroxidase 1 OS=Oryctolagus cuniculus ... [more]
GPX3_MOUSE3.857e-1337.59Glutathione peroxidase 3 OS=Mus musculus GN=Gpx3 P... [more]
GPX1_PANTR5.038e-1332.41Glutathione peroxidase 1 OS=Pan troglodytes GN=GPX... [more]
GPX5_RAT1.122e-1238.35Epididymal secretory glutathione peroxidase OS=Rat... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top