CX296410
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_GRAFK (50S ribosomal protein L7/L12 OS=Gramella forsetii (strain KT0803) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 37/70 (52.86%), Postives = 52/70 (74.29%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEFDV++ P +++AV+K V+ LT L LK+AK L++ PK KEGV+KD+AE K QLEEAGA+V + Sbjct: 55 QTEFDVILT-APGGSKLAVVKLVKELTGLGLKDAKALVDEAPKPVKEGVAKDEAEALKAQLEEAGAEVEL 123
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_GRABC (50S ribosomal protein L7/L12 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 38/70 (54.29%), Postives = 50/70 (71.43%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEF V++ + + +I VIK +R +T L LKEAKDL+EG PK KEGV+KD+AE KK LEE GA V + Sbjct: 56 QTEFTVILAKA-GDKKINVIKEIRTITGLGLKEAKDLVEGAPKTVKEGVNKDEAEKIKKVLEEQGAAVEI 124
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_COREF (50S ribosomal protein L7/L12 OS=Corynebacterium efficiens GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 41/71 (57.75%), Postives = 53/71 (74.65%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTN-LALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 K EFDVV+++ + +I VIK VR L + L LKEAK+L+EG PK EG +KDDAE AK +LEEAGAKV++ Sbjct: 58 KDEFDVVLEDAGAK-KIGVIKVVRELVSGLGLKEAKELVEGAPKAILEGANKDDAEAAKAKLEEAGAKVTL 127
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CLOPH (50S ribosomal protein L7/L12 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 37/70 (52.86%), Postives = 52/70 (74.29%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDV + +V +N ++ VIK VR +T L LKEAKD+++G PK KE SK++A+D K +LE GAKV++ Sbjct: 51 KTEFDVELTDVGAN-KVKVIKVVREVTGLGLKEAKDVVDGAPKVLKEAASKEEADDIKAKLEAEGAKVTL 119
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CLOBM (50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + S +I VIKAVR +T L LKEAK L++G PK KE SK+D E K +LEE GAKV + Sbjct: 53 KTEFDVVLADAGSE-KIKVIKAVREVTGLGLKEAKALVDGAPKTLKEAASKEDGEAIKAKLEEVGAKVEL 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CLOBK (50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + S +I VIKAVR +T L LKEAK L++G PK KE SK+D E K +LEE GAKV + Sbjct: 54 KTEFDVVLADAGSE-KIKVIKAVREVTGLGLKEAKALVDGAPKTLKEAASKEDGEAIKAKLEEVGAKVEL 122
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CLOBJ (50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + S +I VIKAVR +T L LKEAK L++G PK KE SK+D E K +LEE GAKV + Sbjct: 54 KTEFDVVLADAGSE-KIKVIKAVREVTGLGLKEAKALVDGAPKTLKEAASKEDGEAIKAKLEEVGAKVEL 122
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CLOBH (50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + S +I VIKAVR +T L LKEAK L++G PK KE SK+D E K +LEE GAKV + Sbjct: 54 KTEFDVVLADAGSE-KIKVIKAVREVTGLGLKEAKALVDGAPKTLKEAASKEDGEAIKAKLEEVGAKVEL 122
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CLOB6 (50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + S +I VIKAVR +T L LKEAK L++G PK KE SK+D E K +LEE GAKV + Sbjct: 53 KTEFDVVLADAGSE-KIKVIKAVREVTGLGLKEAKALVDGAPKTLKEAASKEDGEAIKAKLEEVGAKVEL 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CLOB1 (50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplL PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.431e-13 Identity = 40/70 (57.14%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + S +I VIKAVR +T L LKEAK L++G PK KE SK+D E K +LEE GAKV + Sbjct: 54 KTEFDVVLADAGSE-KIKVIKAVREVTGLGLKEAKALVDGAPKTLKEAASKEDGEAIKAKLEEVGAKVEL 122 The following BLAST results are available for this feature:
BLAST of CX296410 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 500
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296410 ID=CX296410; Name=CX296410; organism=Citrus clementina; type=EST; length=559bpback to top |