CX296410
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_ARCB4 (50S ribosomal protein L7/L12 OS=Arcobacter butzleri (strain RM4018) GN=rplL PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 7.558e-13 Identity = 41/70 (58.57%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDV+I + + +I VIK +RA+T L LKEAKD E P KEG+SK DAE K QLE AGAKV V Sbjct: 54 KTEFDVIIVD-SGDKKINVIKEIRAITGLGLKEAKDAAEQTPSTIKEGISKADAEAFKAQLEAAGAKVEV 122
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_VIBVY (50S ribosomal protein L7/L12 OS=Vibrio vulnificus (strain YJ016) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 38/70 (54.29%), Postives = 50/70 (71.43%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEF+V++ +N ++AVIKAVR T L LKEAK L++G P KEGV K +AE KK+LEEAGA V + Sbjct: 53 QTEFNVILASAGAN-KVAVIKAVRGATGLGLKEAKALVDGAPAALKEGVEKAEAEALKKELEEAGATVEI 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_VIBVU (50S ribosomal protein L7/L12 OS=Vibrio vulnificus GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 38/70 (54.29%), Postives = 50/70 (71.43%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEF+V++ +N ++AVIKAVR T L LKEAK L++G P KEGV K +AE KK+LEEAGA V + Sbjct: 53 QTEFNVILASAGAN-KVAVIKAVRGATGLGLKEAKALVDGAPAALKEGVEKAEAEALKKELEEAGATVEI 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_SPHWW (50S ribosomal protein L7/L12 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 40/70 (57.14%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 K EFDV++ +I VIK VRA+T L L EAK L+E PK KEGV+KD+AE KKQLEEAGA V + Sbjct: 57 KDEFDVILTG-DGGKKINVIKEVRAITGLGLTEAKTLVESAPKAVKEGVNKDEAEKLKKQLEEAGATVEL 125
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_RHOS5 (50S ribosomal protein L7/L12 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 43/70 (61.43%), Postives = 51/70 (72.86%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + +N +I VIK VRA+T L LKEAKDL+E K KE SK DAE KK+LEEAGAKV + Sbjct: 56 KTEFDVVLTDAGAN-KINVIKEVRAITGLGLKEAKDLVEA-GGKVKEAASKADAEAMKKKLEEAGAKVEL 123
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_PSYA2 (50S ribosomal protein L7/L12 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 K EFDVV+ ++ VIKAVR T L LKEAKDL+E P KEGV+K +AE+ KK+LEEAGA V + Sbjct: 54 KDEFDVVLASF-GEKKVGVIKAVREATGLGLKEAKDLVESAPASIKEGVNKAEAEELKKKLEEAGATVEL 122
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_NITSB (50S ribosomal protein L7/L12 OS=Nitratiruptor sp. (strain SB155-2) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 38/70 (54.29%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDVV+ + +I IK +R +T L LKEAK+ E P KEGVSK++AE+ KKQ EEAGAKV + Sbjct: 58 KTEFDVVLTDAGPK-KINTIKVIRQVTGLGLKEAKEAAENTPTVIKEGVSKEEAEELKKQFEEAGAKVEI 126
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_KINRD (50S ribosomal protein L7/L12 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 39/70 (55.71%), Postives = 52/70 (74.29%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 ++EFDV+++ + +I VIK VRALT+L LKEAKDL++G PK E V+KD AE AK QLE AGA V++ Sbjct: 59 QSEFDVILESA-GDKKIGVIKEVRALTSLGLKEAKDLVDGAPKPVLEKVAKDAAEKAKAQLEGAGATVTL 127
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_CHLPB (50S ribosomal protein L7/L12 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 37/70 (52.86%), Postives = 54/70 (77.14%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEFDV + V +N +I VIKAVR++T L LKEAK++++G PK KE VSK++AE K+L++AGA+V + Sbjct: 57 QTEFDVELKAVGAN-KINVIKAVRSITGLGLKEAKEMVDGAPKVVKEAVSKEEAEKVAKELKDAGAEVEL 125
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_BUCAT (50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplL PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 9.871e-13 Identity = 35/70 (50.00%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFD+ + + N +++VIK VR+ T L LKEAKDL+E P KE +SK+DAE KK LE+ GA++ + Sbjct: 53 KTEFDIFLKVIGPN-KVSVIKTVRSATGLGLKEAKDLVESAPTVLKENISKEDAESLKKTLEDVGAEIEI 121 The following BLAST results are available for this feature:
BLAST of CX296410 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 500
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296410 ID=CX296410; Name=CX296410; organism=Citrus clementina; type=EST; length=559bpback to top |