CX296410
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_BACLD (50S ribosomal protein L7/L12 OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=rplL PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.199e-12 Identity = 36/70 (51.43%), Postives = 50/70 (71.43%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFD+V+ + +I VIK VR +T L LKEAK+L++ PK KEG++K++AE+ K +LEE GA V V Sbjct: 54 KTEFDLVLAGA-GDQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGASVEV 122
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_ALISL (50S ribosomal protein L7/L12 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplL PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.199e-12 Identity = 37/70 (52.86%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEFDV++ + N +++VIKAVR T L LKEAK L++ P KEGV K +AE K QLEEAGA V + Sbjct: 52 QTEFDVILTAIGGN-KVSVIKAVRGATGLGLKEAKGLVDSAPAALKEGVDKAEAEGLKAQLEEAGATVEI 120
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_WOLSU (50S ribosomal protein L7/L12 OS=Wolinella succinogenes GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 39/70 (55.71%), Postives = 47/70 (67.14%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 KTEFDV++ + +I VIK VR LT L LKEAKD +E P KEG +KDDA K +LEEAGAKV + Sbjct: 55 KTEFDVILLD-GGEKKINVIKVVRELTGLGLKEAKDAVEKTPTTIKEGANKDDAAAMKAKLEEAGAKVEI 123
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_VIBFM (50S ribosomal protein L7/L12 OS=Vibrio fischeri (strain MJ11) GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 38/70 (54.29%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 ++EFDV++ +N ++AVIKAVR T L LKEAK L++ P KEGV K +AE K QLEEAGA V V Sbjct: 53 QSEFDVILTSAGAN-KVAVIKAVRGATGLGLKEAKGLVDSAPAPLKEGVDKAEAEALKAQLEEAGASVEV 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_VIBF1 (50S ribosomal protein L7/L12 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 38/70 (54.29%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 ++EFDV++ +N ++AVIKAVR T L LKEAK L++ P KEGV K +AE K QLEEAGA V V Sbjct: 53 QSEFDVILTSAGAN-KVAVIKAVRGATGLGLKEAKGLVDSAPAPLKEGVDKAEAEALKAQLEEAGASVEV 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_RUTMC (50S ribosomal protein L7/L12 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 37/70 (52.86%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 K EFDV++ ++AVIK R++T L LKEAKD++E P KEG SK +AED +KQLEEAGA V + Sbjct: 56 KDEFDVMLTSF-GKKKVAVIKMARSITGLGLKEAKDMVESAPVVIKEGASKVEAEDIQKQLEEAGASVEL 124
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_PSYWF (50S ribosomal protein L7/L12 OS=Psychrobacter sp. (strain PRwf-1) GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 K EFDV++ + ++ VIKAVR T L LKEAK+L+EG P KEG +K +AE+ KK+LEEAGA V + Sbjct: 56 KDEFDVILASF-GDKKVGVIKAVREATGLGLKEAKELVEGAPAPIKEGANKVEAEELKKKLEEAGATVEL 124
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_PSEAE (50S ribosomal protein L7/L12 OS=Pseudomonas aeruginosa GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 38/70 (54.29%), Postives = 50/70 (71.43%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEF +V+ E + ++ VIK VR LT L LKEAK +++G P KEG SK++AE AKK LEEAGAKV + Sbjct: 53 QTEFTIVLAEA-GDKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGASKEEAEAAKKALEEAGAKVEL 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_PSEAB (50S ribosomal protein L7/L12 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 38/70 (54.29%), Postives = 50/70 (71.43%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEF +V+ E + ++ VIK VR LT L LKEAK +++G P KEG SK++AE AKK LEEAGAKV + Sbjct: 53 QTEFTIVLAEA-GDKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGASKEEAEAAKKALEEAGAKVEL 121
BLAST of CX296410 vs. ExPASy Swiss-Prot
Match: RL7_PSEA8 (50S ribosomal protein L7/L12 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplL PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12 Identity = 38/70 (54.29%), Postives = 50/70 (71.43%), Query Frame = 2 Query: 56 KTEFDVVIDEVPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVSKDDAEDAKKQLEEAGAKVSV 265 +TEF +V+ E + ++ VIK VR LT L LKEAK +++G P KEG SK++AE AKK LEEAGAKV + Sbjct: 53 QTEFTIVLAEA-GDKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGASKEEAEAAKKALEEAGAKVEL 121 The following BLAST results are available for this feature:
BLAST of CX296410 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 500
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296410 ID=CX296410; Name=CX296410; organism=Citrus clementina; type=EST; length=559bpback to top |