CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9B_DANRE (SUMO-conjugating enzyme UBC9-B OS=Danio rerio GN=ube2ib PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9A_DANRE (SUMO-conjugating enzyme UBC9-A OS=Danio rerio GN=ube2ia PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2C_DICDI (Probable ubiquitin-conjugating enzyme E2 C OS=Dictyostelium discoideum GN=ube2c PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.170e-12
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            +L   P  G SA   D  N+F W  +I G  DT+YE   F   + FP +YP  PPTV+F ++ +HPNV  +G +C+ IL
Sbjct:   17 NLMMGPSPGISA-FPDGDNIFNWIGTIQGAKDTVYEQMEFKMSLKFPTDYPYKPPTVKFETQCFHPNVDNNGNICLDIL 94          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2E1_MOUSE (Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus GN=Ube2e1 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.170e-12
Identity = 31/79 (39.24%), Postives = 48/79 (60.76%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            D+  +P    SAG   + N++EW ++I+GPP ++YEGG F   +TF   YP  PP V F + ++H N+   G +C+ IL
Sbjct:   58 DITLDPPPNCSAGPKGD-NIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDIL 135          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2E1_HUMAN (Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens GN=UBE2E1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.170e-12
Identity = 31/79 (39.24%), Postives = 48/79 (60.76%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            D+  +P    SAG   + N++EW ++I+GPP ++YEGG F   +TF   YP  PP V F + ++H N+   G +C+ IL
Sbjct:   58 DITLDPPPNCSAGPKGD-NIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDIL 135          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2E3_MOUSE (Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus GN=Ube2e3 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 8.819e-12
Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            ++  +P    SAG   + N++EW ++I+GPP ++YEGG F   +TF  +YP  PP V F + ++H N+   G +C+ IL
Sbjct:   72 EITLDPPPNCSAGPKGD-NIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDIL 149          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2E3_HUMAN (Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens GN=UBE2E3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.819e-12
Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            ++  +P    SAG   + N++EW ++I+GPP ++YEGG F   +TF  +YP  PP V F + ++H N+   G +C+ IL
Sbjct:   72 EITLDPPPNCSAGPKGD-NIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDIL 149          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2E3_BOVIN (Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus GN=UBE2E3 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.819e-12
Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            ++  +P    SAG   + N++EW ++I+GPP ++YEGG F   +TF  +YP  PP V F + ++H N+   G +C+ IL
Sbjct:   72 EITLDPPPNCSAGPKGD-NIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDIL 149          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2E2_MOUSE (Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus GN=Ube2e2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.152e-11
Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            ++  +P    SAG   + N++EW ++I+GPP ++YEGG F   +TF  +YP  PP V F + ++H N+   G +C+ IL
Sbjct:   66 EITLDPPPNCSAGPKGD-NIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDIL 143          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2E2_HUMAN (Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens GN=UBE2E2 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.152e-11
Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            ++  +P    SAG   + N++EW ++I+GPP ++YEGG F   +TF  +YP  PP V F + ++H N+   G +C+ IL
Sbjct:   66 EITLDPPPNCSAGPKGD-NIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDIL 143          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC9B_DANRE3.031e-1246.97SUMO-conjugating enzyme UBC9-B OS=Danio rerio GN=u... [more]
UBC9A_DANRE3.031e-1246.97SUMO-conjugating enzyme UBC9-A OS=Danio rerio GN=u... [more]
UBE2C_DICDI5.170e-1241.77Probable ubiquitin-conjugating enzyme E2 C OS=Dict... [more]
UB2E1_MOUSE5.170e-1239.24Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus... [more]
UB2E1_HUMAN5.170e-1239.24Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens... [more]
UB2E3_MOUSE8.819e-1237.97Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus... [more]
UB2E3_HUMAN8.819e-1237.97Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens... [more]
UB2E3_BOVIN8.819e-1237.97Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus G... [more]
UB2E2_MOUSE1.152e-1137.97Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus... [more]
UB2E2_HUMAN1.152e-1137.97Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top