CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC7_SCHPO (Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe GN=ubc3 PE=2 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 3.336e-27
Identity = 52/98 (53.06%), Postives = 68/98 (69.39%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            +L +N  DG +AG  +E + F W   I GP  T +EGG + A + FP +YP+ PPT++F  E +HPNVY DG VCISILH PGDDPN YE ++ERW+P
Sbjct:   16 ELTENGPDGITAGPSNEDDFFTWDCLIQGPDGTPFEGGLYPATLKFPSDYPLGPPTLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSP 113          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC_ASFB7 (Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=UBC PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.888e-24
Identity = 49/97 (50.52%), Postives = 63/97 (64.95%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L +NP + F    V+E+N+ EW   + GPPDTLYEGG F A + FP  YP +PP + FTSEMWHPN+YPDG++CISILH    +  G       W+P
Sbjct:   13 LIENPSENFKIS-VNENNITEWDVILRGPPDTLYEGGLFKAKVAFPPEYPYAPPKLTFTSEMWHPNIYPDGRLCISILHGDNAEEQGM-----TWSP 103          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC_ASFWA (Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=UBC PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.713e-23
Identity = 49/97 (50.52%), Postives = 63/97 (64.95%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L +NP + F    V+E+++ EW   + GPPDTLYEGG F A + FP  YP +PP + FTSEMWHPN+YPDGK+CISILH    +  G       W+P
Sbjct:   13 LIENPSENFKIS-VNENDMTEWDVILRGPPDTLYEGGLFKAKVAFPPEYPYAPPRLTFTSEMWHPNIYPDGKLCISILHGDNAEEQGM-----TWSP 103          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC_ASFK5 (Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=UBC PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.713e-23
Identity = 49/98 (50.00%), Postives = 63/98 (64.29%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            +L +NP + F    V+E+N+ EW   + GP DT YEGG F A +TFP NYP  PP + FTSEMWHPN+YPDG++CISILH    +  G       W+P
Sbjct:   12 NLTENPSEHFKVS-VNENNLTEWDVILKGPSDTFYEGGLFKAKITFPPNYPYEPPKLTFTSEMWHPNIYPDGRLCISILHTDNVEERGM-----TWSP 103          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC_ASFP4 (Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=UBC PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.110e-22
Identity = 49/97 (50.52%), Postives = 61/97 (62.89%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L +NP + F    V+E+N+ EW   + GP DTLYEGG F A + FP NYP  PP + FTSEMWHPN+Y DG+VCISILH    +  G       W+P
Sbjct:   13 LTENPSENFKVS-VNENNMTEWDVILKGPADTLYEGGLFKAKIGFPPNYPYEPPRLTFTSEMWHPNIYSDGRVCISILHGDNAEEQGM-----TWSP 103          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC_ASFM2 (Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=UBC PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.894e-22
Identity = 49/98 (50.00%), Postives = 60/98 (61.22%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            +L  NP + F    V+E N+ EW   + GPPDTLYEGG F A + FP  YP  PP + FTSEMWHPN+Y DGK+CISILH    +  G       W+P
Sbjct:   12 NLIVNPSEHFKIS-VNEDNLTEWDVILKGPPDTLYEGGLFKAKIVFPPKYPYEPPRLTFTSEMWHPNIYSDGKLCISILHGDNAEEQGM-----TWSP 103          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC3_YEAST (Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae GN=CDC34 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.798e-20
Identity = 45/96 (46.88%), Postives = 61/96 (63.54%), Query Frame = -2
Query:    1 KNPVDGFSAGLVDESNVFEWSASI-IGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 285
            K  +  F   L D+SN+F W+  + +   D++Y GGFF A M FP+++P SPP  RFT  ++HPNVY DG++CISILH  G DP   E   E W+P
Sbjct:   23 KKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSG-DPMTDEPDAETWSP 117          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC11_SCHPO (Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe GN=ubc11 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.028e-16
Identity = 38/71 (53.52%), Postives = 46/71 (64.79%), Query Frame = -2
Query:   58 GFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 270
            G SA    +SN+  W+ +I GP DT YEG  F   M+FP NYP SPPT+ FTS MWHPNV   G +C+ IL
Sbjct:   47 GISAFPDSDSNLLHWAGTITGPSDTYYEGLKFKISMSFPANYPYSPPTIIFTSPMWHPNVDMSGNICLDIL 117          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2B_RAT (Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E+N+ +W+A I GP  T +E G F  ++ F + YP  PPTVRF S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2B_RABIT (Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E+N+ +W+A I GP  T +E G F  ++ F + YP  PPTVRF S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDIL 92          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC7_SCHPO3.336e-2753.06Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosa... [more]
UBC_ASFB75.888e-2450.52Ubiquitin-conjugating enzyme E2 OS=African swine f... [more]
UBC_ASFWA1.713e-2350.52Ubiquitin-conjugating enzyme E2 OS=African swine f... [more]
UBC_ASFK51.713e-2350.00Ubiquitin-conjugating enzyme E2 OS=African swine f... [more]
UBC_ASFP41.110e-2250.52Ubiquitin-conjugating enzyme E2 OS=African swine f... [more]
UBC_ASFM21.894e-2250.00Ubiquitin-conjugating enzyme E2 OS=African swine f... [more]
UBC3_YEAST8.798e-2046.88Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharo... [more]
UBC11_SCHPO2.028e-1653.52Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosa... [more]
UBE2B_RAT1.717e-1547.44Ubiquitin-conjugating enzyme E2 B OS=Rattus norveg... [more]
UBE2B_RABIT1.717e-1547.44Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top