CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2B_MOUSE (Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E+N+ +W+A I GP  T +E G F  ++ F + YP  PPTVRF S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2B_HUMAN (Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E+N+ +W+A I GP  T +E G F  ++ F + YP  PPTVRF S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2B_BOVIN (Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E+N+ +W+A I GP  T +E G F  ++ F + YP  PPTVRF S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC3_ARATH (Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L K+P  G S G   ++N+  W+A I GP DT ++GG F   + F ++YP  PP VRF S M+HPN+Y DG +C+ IL
Sbjct:   16 LQKDPPVGIS-GAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 36/78 (46.15%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   ++N+  W+A I GP DT ++GG F   + F ++YP  PPTVRF S M+HPN+Y DG +C+ IL
Sbjct:   16 LQQDPPAGIS-GAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.717e-15
Identity = 36/78 (46.15%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   ++N+  W+A I GP DT ++GG F   + F ++YP  PPTVRF S M+HPN+Y DG +C+ IL
Sbjct:   16 LQQDPPAGIS-GAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.929e-15
Identity = 36/78 (46.15%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   ++N+  W+A I GP DT ++GG F   + F ++YP  PPTVRF S M+HPN+Y DG +C+ IL
Sbjct:   16 LQQDPPAGIS-GAPHDNNITLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.929e-15
Identity = 35/75 (46.67%), Postives = 49/75 (65.33%), Query Frame = -2
Query:   58 NPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 282
            +P  G S G   ++N+  W+A I GP DT ++GG F   + F ++YP  PPTVRF S M+HPN+Y DG +C+ IL
Sbjct:   19 DPPAGIS-GAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_NEUCR (Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa GN=mus-8 PE=3 SV=3)

HSP 1 Score: 80.1073 bits (196), Expect = 3.825e-15
Identity = 38/75 (50.67%), Postives = 50/75 (66.67%), Query Frame = -2
Query:   58 NPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 282
            +P  G SA  V + NV  W+A IIGP DT +E G F  +M F + YP  PP+V+F SEM+HPNVY  G++C+ IL
Sbjct:   19 DPPAGVSASPVPD-NVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPSVKFISEMFHPNVYATGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_CRYNE (Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans GN=UBC2 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.825e-15
Identity = 33/68 (48.53%), Postives = 47/68 (69.12%), Query Frame = -2
Query:   58 AGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 261
            +G  +  N+  W+A I GPP+T +E G F   +TF D YP  PPTVRF S+M+HPN+Y +G++C+ IL
Sbjct:   25 SGSPNPDNIMVWNAVIFGPPETPFEDGSFRLTLTFTDAYPNKPPTVRFISKMFHPNIYANGELCLDIL 92          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBE2B_MOUSE1.717e-1547.44Ubiquitin-conjugating enzyme E2 B OS=Mus musculus ... [more]
UBE2B_HUMAN1.717e-1547.44Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens ... [more]
UBE2B_BOVIN1.717e-1547.44Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN... [more]
UBC3_ARATH1.717e-1546.15Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis t... [more]
UBC2_ARATH1.717e-1546.15Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis t... [more]
UBC1_ARATH1.717e-1546.15Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis t... [more]
UBC2_WHEAT2.929e-1546.15Ubiquitin-conjugating enzyme E2 2 OS=Triticum aest... [more]
UBC2_MEDSA2.929e-1546.67Ubiquitin-conjugating enzyme E2 2 OS=Medicago sati... [more]
UBC2_NEUCR3.825e-1550.67Ubiquitin-conjugating enzyme E2 2 OS=Neurospora cr... [more]
UBC2_CRYNE3.825e-1548.53Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top