CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_CANGA (Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata GN=UBC2 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.825e-15
Identity = 37/80 (46.25%), Postives = 48/80 (60.00%), Query Frame = -2
Query:    1 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 240
            NV  W+A IIGP DT YE G F  ++ F ++YP  PP V+F SEM+HPNVY +G++C+ IL               RWTP
Sbjct:   32 NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMFHPNVYANGEICLDILQ-------------NRWTP 98          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_CANAL (Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans GN=UBC2 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.825e-15
Identity = 36/76 (47.37%), Postives = 52/76 (68.42%), Query Frame = -2
Query:   58 KNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 285
            ++P  G SA  + + NV +W+A IIGP DT +E G F  +++F + YP  PP V+F SEM+HPNVY  G++C+ IL
Sbjct:   18 QDPPSGVSASPLPD-NVMKWNAVIIGPSDTPFEDGTFRLLLSFDEQYPNKPPQVKFISEMFHPNVYASGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_YEAST (Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae GN=RAD6 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.996e-15
Identity = 37/80 (46.25%), Postives = 47/80 (58.75%), Query Frame = -2
Query:    1 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 240
            NV  W+A IIGP DT YE G F  ++ F + YP  PP V+F SEM+HPNVY +G++C+ IL               RWTP
Sbjct:   32 NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQ-------------NRWTP 98          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_NECHA (Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.996e-15
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = -2
Query:   58 NPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 282
            +P  G SA  V + NV  W+A IIGP DT +E G F  +M F + YP  PP V+F SEM+HPNVY  G++C+ IL
Sbjct:   19 DPPAGVSASPVPD-NVMTWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPQVKFISEMFHPNVYATGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_ASHGO (Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.996e-15
Identity = 37/80 (46.25%), Postives = 47/80 (58.75%), Query Frame = -2
Query:    1 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 240
            NV  W+A IIGP DT YE G F  ++ F + YP  PP V+F SEM+HPNVY +G++C+ IL               RWTP
Sbjct:   32 NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQ-------------NRWTP 98          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D1_MOUSE (Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.996e-15
Identity = 34/79 (43.04%), Postives = 54/79 (68.35%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GPPD+ Y+GG F   + FP +YP  PP + FT++++HPN+  +G +C+ IL
Sbjct:   12 DLQRDPPAHCSAGPVGD-DLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D1_HUMAN (Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.996e-15
Identity = 34/79 (43.04%), Postives = 54/79 (68.35%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GPPD+ Y+GG F   + FP +YP  PP + FT++++HPN+  +G +C+ IL
Sbjct:   12 DLQRDPPAHCSAGPVGD-DLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D1_BOVIN (Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.996e-15
Identity = 34/79 (43.04%), Postives = 54/79 (68.35%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GPPD+ Y+GG F   + FP +YP  PP + FT++++HPN+  +G +C+ IL
Sbjct:   12 DLQRDPPAHCSAGPVGD-DLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_KLULA (Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.525e-15
Identity = 37/80 (46.25%), Postives = 47/80 (58.75%), Query Frame = -2
Query:    1 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 240
            NV  W+A IIGP DT YE G F  ++ F + YP  PP V+F SEM+HPNVY +G++C+ IL               RWTP
Sbjct:   32 NVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQ-------------NRWTP 98          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC14_SCHPO (Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccharomyces pombe GN=ubc14 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.525e-15
Identity = 33/79 (41.77%), Postives = 53/79 (67.09%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P+      LVD+ N+F W+ + +GP D++Y GG F+  + FP +YP  PPT+ FT+ ++HPN   +G VC++IL
Sbjct:   18 DLREHPIPDIRVNLVDD-NLFHWACTALGPSDSVYAGGKFHFSLKFPLDYPFQPPTIEFTTRIYHPNFDSEGNVCLAIL 95          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC2_CANGA3.825e-1546.25Ubiquitin-conjugating enzyme E2 2 OS=Candida glabr... [more]
UBC2_CANAL3.825e-1547.37Ubiquitin-conjugating enzyme E2 2 OS=Candida albic... [more]
UBC2_YEAST4.996e-1546.25Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces... [more]
UBC2_NECHA4.996e-1550.67Ubiquitin-conjugating enzyme E2 2 OS=Nectria haema... [more]
UBC2_ASHGO4.996e-1546.25Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossyp... [more]
UB2D1_MOUSE4.996e-1543.04Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus... [more]
UB2D1_HUMAN4.996e-1543.04Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens... [more]
UB2D1_BOVIN4.996e-1543.04Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus G... [more]
UBC2_KLULA6.525e-1546.25Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces... [more]
UBC14_SCHPO6.525e-1541.77Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top