CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC1_CAEEL (Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 36/78 (46.15%), Postives = 48/78 (61.54%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E N+  W A I GP +T +E G F   + F + YP  PPTV+F S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPAGVS-GAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 35/79 (44.30%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL K+P    SAG V E ++F W A+I+GPP++ Y GG F   + FP +YP  PP V F ++++HPN+  +G +C+ IL
Sbjct:   12 DLQKDPPSNCSAGPVAE-DMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: U2D2B_RAT (Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 36/79 (45.57%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V E ++F W A+I+GP D+ Y+GG F   + FP  YP  PP V FT+ ++HPNV  +G +C+ IL
Sbjct:   12 DLAQDPPAQCSAGPVGE-DMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: U2D2B_MOUSE (Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 36/79 (45.57%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V E ++F W A+I+GP D+ Y+GG F   + FP  YP  PP V FT+ ++HPNV  +G +C+ IL
Sbjct:   12 DLAQDPPAQCSAGPVGE-DMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBCD6_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=UbcD6 PE=2 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 2.479e-14
Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   ++N+  W+A I GP DT +E G F   + F + YP  PPTVRF S+++HPNVY DG +C+ IL
Sbjct:   16 LQEDPPTGVS-GAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.479e-14
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL K+P    SAG V + ++F W A+I+GP D+ Y GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLGKDPPSSCSAGPVGD-DLFHWQATIMGPADSPYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC4_CANAL (Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.479e-14
Identity = 33/79 (41.77%), Postives = 53/79 (67.09%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + +++ W ASI+GPPD+ Y GG F   + FP +YP+ PP +  T++++HPN+  +G +C+ IL
Sbjct:   12 DLGRDPPSSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPLKPPKIALTTKIYHPNINSNGNICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_CAEEL (Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.479e-14
Identity = 34/79 (43.04%), Postives = 53/79 (67.09%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GPP++ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLGRDPPAQCSAGPVGD-DLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_EMENI (Ubiquitin-conjugating enzyme E2 2 OS=Emericella nidulans GN=uvsJ PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.238e-14
Identity = 37/75 (49.33%), Postives = 49/75 (65.33%), Query Frame = -2
Query:   58 NPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 282
            +P  G SA  V + NV  W+A IIGP DT +E G F  +M F + YP  PP V+F S+M+HPNVY  G++C+ IL
Sbjct:   19 DPPAGVSASPVAD-NVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_ASPFU (Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus fumigatus GN=ubc2 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.238e-14
Identity = 37/75 (49.33%), Postives = 49/75 (65.33%), Query Frame = -2
Query:   58 NPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 282
            +P  G SA  V + NV  W+A IIGP DT +E G F  +M F + YP  PP V+F S+M+HPNVY  G++C+ IL
Sbjct:   19 DPPAGVSASPVAD-NVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDIL 92          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC1_CAEEL1.898e-1446.15Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditi... [more]
UBC11_ARATH1.898e-1444.30Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
U2D2B_RAT1.898e-1445.57Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norv... [more]
U2D2B_MOUSE1.898e-1445.57Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculu... [more]
UBCD6_DROME2.479e-1446.15Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBC4_SCHPO2.479e-1444.30Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]
UBC4_CANAL2.479e-1441.77Ubiquitin-conjugating enzyme E2 4 OS=Candida albic... [more]
UBC2_CAEEL2.479e-1443.04Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditi... [more]
UBC2_EMENI3.238e-1449.33Ubiquitin-conjugating enzyme E2 2 OS=Emericella ni... [more]
UBC2_ASPFU3.238e-1449.33Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus f... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top