CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D2_MOUSE (Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D2_HUMAN (Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D2_BOVIN (Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.524e-14
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL K+P    SAG V E ++F W A+I+GP D+ Y GG F   + FP +YP  PP V F ++++HPN+  +G +C+ IL
Sbjct:   12 DLQKDPPTSCSAGPVAE-DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D4_HUMAN (Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.214e-14
Identity = 34/79 (43.04%), Postives = 53/79 (67.09%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT++++HPN+  +G +C+ IL
Sbjct:   12 DLQRDPPAQCSAGPVGD-DLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC5_YEAST (Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae GN=UBC5 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.422e-14
Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + +++ W ASI+GP D+ Y GG F   + FP +YP  PP V FT++++HPN+   G +C+ IL
Sbjct:   13 DLGRDPPASCSAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDIL 90          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.422e-14
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL K+P    SAG V E ++F W A+I+GP D+ Y GG F   + FP +YP  PP V F ++++HPN+  +G +C+ IL
Sbjct:   12 DLQKDPPTSCSAGPVAE-DMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_DICDI (Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 9.422e-14
Identity = 35/78 (44.87%), Postives = 48/78 (61.54%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L  +P  G S G   E+N+  W A I GP D+++EG  F   + F + YP   PTV+F S+M+HPNVY DG +C+ IL
Sbjct:   16 LQSDPPAGIS-GAPLENNILMWQAVIFGPDDSIWEGATFKLSLQFSEEYPNDAPTVKFLSKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC4_YEAST (Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae GN=UBC4 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.231e-13
Identity = 33/79 (41.77%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + +++ W ASI+GP D+ Y GG F   + FP +YP  PP + FT++++HPN+  +G +C+ IL
Sbjct:   13 DLERDPPTSCSAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDIL 90          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: Y1A1_ENCCU (Probable ubiquitin-conjugating enzyme E2 ECU01_1010 OS=Encephalitozoon cuniculi GN=ECU01_1010 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.607e-13
Identity = 34/90 (37.78%), Postives = 52/90 (57.78%), Query Frame = -2
Query:    1 FSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL-HPPGDDPNGYELATERWTP 267
            +  G ++  +   W        D+LY G    A+M FP +YP+ PPT++F S+M+HPN+Y DGK+CISIL      D + +    ++WTP
Sbjct:   55 YPRGSMENRDYKVWDIYFTLGGDSLYAGRILKAVMKFPSSYPLRPPTLKFVSKMFHPNIYEDGKMCISILEEDKQQDSSVFGDPKDKWTP 144          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UB2D2_MOUSE4.229e-1443.04Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus... [more]
UB2D2_HUMAN4.229e-1443.04Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens... [more]
UB2D2_BOVIN4.229e-1443.04Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus G... [more]
UBC9_ARATH5.524e-1444.30SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UB2D4_HUMAN7.214e-1443.04Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens... [more]
UBC5_YEAST9.422e-1443.04Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharo... [more]
UBC4_SOLLC9.422e-1444.30Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC2_DICDI9.422e-1444.87Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium... [more]
UBC4_YEAST1.231e-1341.77Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces... [more]
Y1A1_ENCCU1.607e-1337.78Probable ubiquitin-conjugating enzyme E2 ECU01_101... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top