DY270393
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DY270393 vs. ExPASy Swiss-Prot
Match: E13H_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q' OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.327e-12 Identity = 36/53 (67.92%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 2 KAGPCSLDIVISESGWPTAGGDGALTNVFNARTYNNNLIQHVKQGSPKKPGRP 160 KA SL+IV+SESGWP+AG G LT++ NARTYNNNLI HVK GSPK+P P Sbjct: 250 KASGSSLEIVVSESGWPSAGA-GQLTSIDNARTYNNNLISHVKGGSPKRPSGP 301
BLAST of DY270393 vs. ExPASy Swiss-Prot
Match: E13A_SOYBN (Glucan endo-1,3-beta-glucosidase OS=Glycine max PE=1 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.467e-11 Identity = 33/53 (62.26%), Postives = 44/53 (83.02%), Query Frame = 2 Query: 2 KAGPCSLDIVISESGWPTAGGDGALTNVFNARTYNNNLIQHVKQGSPKKPGRP 160 KAG SL+IV+SESGWP++GG T++ NARTYN NL+++VKQG+PK+PG P Sbjct: 258 KAGGGSLNIVVSESGWPSSGGTA--TSLDNARTYNTNLVRNVKQGTPKRPGAP 308
BLAST of DY270393 vs. ExPASy Swiss-Prot
Match: E13A_ARATH (Glucan endo-1,3-beta-glucosidase, acidic isoform OS=Arabidopsis thaliana GN=BG2 PE=1 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 5.574e-11 Identity = 33/52 (63.46%), Postives = 42/52 (80.77%), Query Frame = 2 Query: 2 KAGPCSLDIVISESGWPTAGGDGALTNVFNARTYNNNLIQHVKQGSPKKPGR 157 K+G SL+IV+SE+GWPT G G T+V NA+TY NNLIQHVK GSP++PG+ Sbjct: 251 KSGGGSLEIVVSETGWPTEGAVG--TSVENAKTYVNNLIQHVKNGSPRRPGK 300
BLAST of DY270393 vs. ExPASy Swiss-Prot
Match: E13B_PRUPE (Glucan endo-1,3-beta-glucosidase, basic isoform OS=Prunus persica GN=GNS1 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 9.508e-11 Identity = 32/53 (60.38%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 2 KAGPCSLDIVISESGWPTAGGDGALTNVFNARTYNNNLIQHVKQGSPKKPGRP 160 KAG SL +VISE+GWP+A G T + NART+ +NLIQHVK+G+P++PGRP Sbjct: 262 KAGGGSLKVVISETGWPSAAGTA--TTIDNARTFISNLIQHVKEGTPRRPGRP 312 The following BLAST results are available for this feature:
BLAST of DY270393 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY270393 ID=DY270393; Name=DY270393; organism=Citrus clementina; type=EST; length=1291bpback to top |