FC868790

Overview
NameFC868790
Unique NameFC868790
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length682
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9400 contig Ccv1_Contig9400:1..682. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: TOC34_ARATH (Translocase of chloroplast 34, chloroplastic OS=Arabidopsis thaliana GN=TOC34 PE=1 SV=2)

HSP 1 Score: 253.062 bits (645), Expect = 1.031e-66
Identity = 124/176 (70.45%), Postives = 147/176 (83.52%), Query Frame = 1
Query:  154 ASQVIREWMGIQQFPPATQTXXXXXXXXXXQENVNTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDGLDYEVFCS 681
            A Q +REW+GIQQFPPATQ+          +E+V++LT+LVMGKGGVGKSSTVNS+IGEKA  VSTFQSEG RP +VSR+R+GFTLNI+DTPGLIEGGYVN  AI +IKRFLLN TIDVLLYVDRLDVYRVD+LD+Q+  AITD FG++IWK++ +VLTHAQ S PDGL+Y  F S
Sbjct:    3 ALQTLREWIGIQQFPPATQSKLLEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGLRPTLVSRTRSGFTLNIIDTPGLIEGGYVNDQAINIIKRFLLNMTIDVLLYVDRLDVYRVDDLDRQVVGAITDAFGKEIWKKSALVLTHAQFSPPDGLNYNHFVS 178          
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: TOC34_PEA (Translocase of chloroplast 34 OS=Pisum sativum GN=TOC34 PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.759e-66
Identity = 124/179 (69.27%), Postives = 144/179 (80.45%), Query Frame = 1
Query:  145 MSMASQVIREWMGIQQFPPATQTXXXXXXXXXXQENVNTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDGLDYEVFCS 681
            M+   Q +REW GI  F PATQT          QE+VN+LTILVMGKGGVGKSSTVNSIIGE+ V++S FQSEGPRPVMVSRSRAGFTLNI+DTPGLIEGGY+N  A+ +IK FLL+KTIDVLLYVDRLD YRVDNLDK + +AITD+FG+ IW +A++ LTHAQ S PDGL Y+ F S
Sbjct:    1 MASQQQTVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFS 179          
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: TOC33_ARATH (Translocase of chloroplast 33, chloroplastic OS=Arabidopsis thaliana GN=TOC33 PE=1 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.460e-60
Identity = 111/173 (64.16%), Postives = 138/173 (79.77%), Query Frame = 1
Query:  163 VIREWMGIQQFPPATQTXXXXXXXXXXQENVNTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDGLDYEVFCS 681
            ++REW+G QQFP ATQ           Q+++N++T+LV+GKGGVGKSSTVNS+IGE+ V VS FQ+EG RPVMVSR+  GFT+NI+DTPGL+E GYVN+ A++LIK FL+N+TIDVLLYVDRLDVYRVD LDKQ+  AIT  FG++IW + L+VLTHAQ S PD L YE F S
Sbjct:    4 LVREWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSS 176          
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: TC159_ARATH (Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana GN=TOC159 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.613e-19
Identity = 55/152 (36.18%), Postives = 82/152 (53.95%), Query Frame = 1
Query:  244 QENVNTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGGY---VNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDG-----LDYEVF 675
            +E + +L ILV+GK GVGKS+T+NSI+G +  ++  F         +S +  G  +  +DTPGL         N   +  +K+ +     D++LYVDRLD    D  +  + R IT + G  IWK A++ LTHA  + PDG     L Y+VF
Sbjct:  850 EELIFSLNILVLGKAGVGKSATINSILGNQIASIDAFGLSTTSVREISGTVNGVKITFIDTPGLKSAAMDQSTNAKMLSSVKKVMKKCPPDIVLYVDRLDTQTRDLNNLPLLRTITASLGTSIWKNAIVTLTHAASAPPDGPSGTPLSYDVF 1001          
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: TC120_ARATH (Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana GN=TOC120 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.107e-19
Identity = 50/134 (37.31%), Postives = 77/134 (57.46%), Query Frame = 1
Query:  265 TILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGG---YVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDG 657
            TI+V+GK GVGKS+T+NSI  E  ++   FQ    +   +     G  + ++DTPGL+      + N   ++ ++ F+     D++LY+DRLD+   D+ D  + R ITD FG  IW  A++ LTHA  + PDG
Sbjct:  458 TIMVLGKSGVGKSATINSIFDELKISTDAFQVGTKKVQDIEGFVQGIKVRVIDTPGLLPSWSDQHKNEKILKSVRAFIKKSPPDIVLYLDRLDMQSRDSGDMPLLRTITDVFGPSIWFNAIVGLTHAASAPPDG 591          
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: TC132_ARATH (Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana GN=TOC132 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.042e-18
Identity = 52/134 (38.81%), Postives = 72/134 (53.73%), Query Frame = 1
Query:  265 TILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGGY---VNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDG 657
            TI+V+GK GVGKS+T+NSI  E       FQ    R   V     G  + ++DTPGL+        N   +  +K F+     D++LY+DRLD+   D+ D  + R I+D FG  IW  A++ LTHA    PDG
Sbjct:  576 TIMVLGKSGVGKSATINSIFDEVKFCTDAFQMGTKRVQDVEGLVQGIKVRVIDTPGLLPSWSDQAKNEKILNSVKAFIKKNPPDIVLYLDRLDMQSRDSGDMPLLRTISDVFGPSIWFNAIVGLTHAASVPPDG 709          
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: GTPA_DICDI (GTP-binding protein A OS=Dictyostelium discoideum GN=gtpA PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.156e-17
Identity = 50/135 (37.04%), Postives = 79/135 (58.52%), Query Frame = 1
Query:  256 NTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIE--GGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPD 654
            N   +L++G+ GVGKSST+N++ G   + V + +S    P   SR   GF LNI+DTPG ++  G  V+ + +  I+R+L  KTI  +L+V++    R D   + +    T+  G Q+W+ A +VLT+A   LPD
Sbjct:  150 NECNVLLLGRTGVGKSSTLNTVFGID-IPVHSSESCTQDPFTYSRVVNGFKLNIIDTPGFLDSQGELVDSNNMIKIQRYLSGKTIHCVLFVEKFTETRFDGAHQLVINQFTEKLGPQLWRNAAVVLTYANSVLPD 283          
BLAST of FC868790 vs. ExPASy Swiss-Prot
Match: TOC90_ARATH (Translocase of chloroplast 90, chloroplastic OS=Arabidopsis thaliana GN=TOC90 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.196e-14
Identity = 46/130 (35.38%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  259 TLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGL----IEGGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHA 636
            +L ILV+GK GVGKS+T+NSI G+       F+    R   V  + +G  +  +DTPG           N   +  IKR++  +  DV+LY+DRLD+  +   D  + + IT+ FG  IW   ++V+TH+
Sbjct:  166 SLRILVLGKTGVGKSATINSIFGQPKSETDAFRPGTDRIEEVMGTVSGVKVTFIDTPGFHPLSSSSTRKNRKILLSIKRYVKKRPPDVVLYLDRLDMIDMRYSDFSLLQLITEIFGAAIWLNTILVMTHS 295          
The following BLAST results are available for this feature:
BLAST of FC868790 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
TOC34_ARATH1.031e-6670.45Translocase of chloroplast 34, chloroplastic OS=Ar... [more]
TOC34_PEA1.759e-6669.27Translocase of chloroplast 34 OS=Pisum sativum GN=... [more]
TOC33_ARATH2.460e-6064.16Translocase of chloroplast 33, chloroplastic OS=Ar... [more]
TC159_ARATH1.613e-1936.18Translocase of chloroplast 159, chloroplastic OS=A... [more]
TC120_ARATH2.107e-1937.31Translocase of chloroplast 120, chloroplastic OS=A... [more]
TC132_ARATH3.042e-1838.81Translocase of chloroplast 132, chloroplastic OS=A... [more]
GTPA_DICDI1.156e-1737.04GTP-binding protein A OS=Dictyostelium discoideum ... [more]
TOC90_ARATH1.196e-1435.38Translocase of chloroplast 90, chloroplastic OS=Ar... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31004G11EF AbioticL1 Citrus clementina cDNA clone C31004G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868790 ID=FC868790|Name=FC868790|organism=Citrus clementina|type=EST|length=682bp
GGCTCTGGTTTTGGGTTTAAGGTCTCAGCAGTAGCAGACGAGGTGCAAAC
AAATTCCCCAAAAACCCAAATTCACACTCTCCGCATTAAATTTCTCTTCT
ATGTGAACTCTACGGTCACATTTTTCAATTTGTAGGACAGACATATGTCT
ATGGCGTCTCAAGTAATACGTGAATGGATGGGAATTCAGCAGTTCCCACC
TGCCACTCAAACAAAATTGCTTGAATTGTTGGGAAAACTTAAACAAGAGA
ATGTGAACACATTGACCATACTTGTGATGGGGAAGGGTGGCGTTGGGAAA
TCATCAACTGTAAACTCTATCATAGGAGAGAAAGCGGTTACTGTTAGTAC
GTTTCAGTCGGAAGGACCAAGACCTGTGATGGTTTCCCGCTCCAGGGCTG
GATTTACATTGAACATTGTTGACACTCCTGGGCTCATAGAAGGTGGATAT
GTCAATTATCATGCTATTCAGCTAATCAAACGTTTCCTTCTGAACAAAAC
TATCGATGTTCTACTGTATGTCGACCGTCTGGATGTTTATAGGGTAGATA
ATTTGGATAAGCAGATTACTAGAGCCATAACGGATAATTTTGGTGAACAA
ATATGGAAGAGGGCTTTGATTGTTCTCACACATGCTCAACTCTCATTGCC
AGACGGATTAGATTATGAAGTTTTTTGCTCCA
back to top