FC868796

Overview
NameFC868796
Unique NameFC868796
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length757
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868796 vs. ExPASy Swiss-Prot
Match: FDL1_ARATH (F-box/FBD/LRR-repeat protein At1g13570 OS=Arabidopsis thaliana GN=At1g13570 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.165e-14
Identity = 64/198 (32.32%), Postives = 95/198 (47.98%), Query Frame = 3
Query:  189 DWISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWTFTTCLNFSALKMLWNVKKDPATLEEERYNYINWVNDVLDSHMGLCINEFRLCFELRNSHGSFITHWIFTALAKKVQKLELNLHPVGGGFWPPLELYAFPPECLKL---------FRSPRTLSNIKSLRSLCLDAVNVSGEVLEFFIYSCPLSARLRVGLF 755
            D+IS LP  I+ NI++RL++R+A RTSVLSS+W+Y W+  T L F   +   +   D   +E    N + ++  VL  H G  I++F+L    +      I  W+       +++L L L    G F  P  L+     CLKL         F  P+       L+SL L  + V+ EV+E  I  CPL   L +  F
Sbjct:    6 DFISDLPQSIIENILTRLSIRDAIRTSVLSSKWRYKWSTLTDLVFD--EKCVSPSNDRCVVET---NLVRFITGVLLLHQG-PIHKFQLSTSFKQCRPD-IDQWLLFLSRNGIKELVLKLGE--GEFRVPACLF----NCLKLTCLELCHCEFDPPQYFKGFSYLKSLNLHQILVAPEVIESLISGCPLLEFLSLSYF 190          
BLAST of FC868796 vs. ExPASy Swiss-Prot
Match: FDL32_ARATH (Putative F-box/FBD/LRR-repeat protein At5g22670 OS=Arabidopsis thaliana GN=At5g22670 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.855e-13
Identity = 60/205 (29.27%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  159 LDTKQDEILVDWISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWTFTTCLNFSALKMLWNVKKDPATLEEERYNYINWVNDVLDSHMGLCINEFRLCFELRNSHGSFITHWIFTALAKKVQKLELNLHPVGGGFWPPLELYAFPPECLKLFRSPR---------TLSNIKSLRSLCLDAVNVSGEVLEFFIYSCPLSARLRV 746
            + TK+     D IS LPD++L  I+S L  + A RTSVLS RWK        L F+  +                Y +   V+  LD+    CI++ +L FE +    S++T WI  A+ +KVQ L++      G    P  LY    E L   R            +L  +K++    +D +  +  +LE  I SCP+   L V
Sbjct:    1 MSTKRGVTSQDSISLLPDDLLCRILSNLPTKVAVRTSVLSKRWKRFSLSVPLLEFNVSEF------------HGYYEFARVVHGFLDTSRETCIHKLKLAFEKKQHDRSYLTQWIHNAVKRKVQHLDIGRWSYLGQELIPHSLYTC--ETLVSLRLHNVSLPDFDHVSLPRLKTMH--LIDNIYPNDALLENLISSCPVLEDLNV 189          
BLAST of FC868796 vs. ExPASy Swiss-Prot
Match: FBL39_ARATH (F-box/LRR-repeat protein At2g42730 OS=Arabidopsis thaliana GN=At2g42730 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.286e-12
Identity = 62/198 (31.31%), Postives = 93/198 (46.97%), Query Frame = 3
Query:  189 DWISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWTFTTCLNFSALKMLWNVKKDPATLEEERYNYINWVNDVLDSHMGLCINEFRLCFEL---RNSHGSFITHWIFTALAKKVQKLELNLHPVGGGFWPPLELYAFPPECLKLFRSPRTLS-------NIKSLRSLCLDAVNVSG--EVLEFFIYSCPLSARLRV 746
            D ISRLPDE+L  I+S ++ +EA  TSVLS RWK ++   + L+    +   +V K      E   NY+ +V+ +LD+  G  I +  L   +     +  S I  WI   L   V  L++ +   G    PP+    F  + L   R  R  +       ++  LR+LCLD+VN  G   V+   I  CP+   L V
Sbjct:    5 DVISRLPDEVLGRILSLISTKEAVSTSVLSKRWKNMFVLVSNLDIDDRQ---SVPKTKQNRIEIHRNYMAFVDKLLDTQRGSSIKKLTLKSHVGVRGGTDSSRIQSWICNVLDHGVMDLDVFITLKGKS--PPVPAMIFKSKTLVKLRVGRGFTIKLSQDVSLPLLRTLCLDSVNFVGGHNVVGTLISRCPVLEELVV 197          
BLAST of FC868796 vs. ExPASy Swiss-Prot
Match: FBD31_ARATH (Putative FBD-associated F-box protein At5g53630 OS=Arabidopsis thaliana GN=At5g53630 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.092e-12
Identity = 53/192 (27.60%), Postives = 94/192 (48.96%), Query Frame = 3
Query:  195 ISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWTFTTCLNFSALKMLWNVKKDPATLEEERYNYINWVNDVLDSHMGLCINEFRLC---FELRNSHGSFITHWIFTALAKKVQKLELNLHPVGGGFWPPLELYAFPP-ECLKLFR---SPRTLSNIKSLRSLCLDAVNVSGEV-LEFFIYSCPLSARLRV 746
            IS+LPD ++ +I+S L +++   T VLS+RW+ LW +  CL  ++L               +   ++++ +   DS+   CIN+F+L    +++     S++T WI  A+  K+Q L +   P    +  PL LY       LKL R         ++  L+++ L+ V    E  LE F+  CP+   L++
Sbjct:    2 ISQLPDPLICHILSHLPIKDLVTTRVLSTRWRSLWLWLPCLELNSLYF------------PDFNAFVSFGDKFFDSNRVSCINKFKLYIYGYDVGVDDPSYLTSWIDAAVKCKIQHLHVQCLPAKYIYEMPLSLYICETLVYLKLCRVMLDDAEFVSLPCLKTIHLEYVWFPNEANLERFVSCCPVLEELKI 181          
The following BLAST results are available for this feature:
BLAST of FC868796 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
FDL1_ARATH4.165e-1432.32F-box/FBD/LRR-repeat protein At1g13570 OS=Arabidop... [more]
FDL32_ARATH7.855e-1329.27Putative F-box/FBD/LRR-repeat protein At5g22670 OS... [more]
FBL39_ARATH2.286e-1231.31F-box/LRR-repeat protein At2g42730 OS=Arabidopsis ... [more]
FBD31_ARATH5.092e-1227.60Putative FBD-associated F-box protein At5g53630 OS... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31004H05EF AbioticL1 Citrus clementina cDNA clone C31004H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868796 ID=FC868796|Name=FC868796|organism=Citrus clementina|type=EST|length=757bp
GGGGATTTTGCACCGCAGCGGATCCTCCCTCACCACAGCACTAATTGTTG
TACGGAACGGAACCATTTAAGAAGAGCAACGAAATCTCAATTTATCCTAA
AGCTGGGGTTTGAGAGTCCATTTTTCGGAGAAAAATGAGCAAAAGAGCTC
GGCTTGAGCTGGATACTAAGCAAGATGAAATTTTAGTGGATTGGATTAGT
CGACTCCCAGATGAAATTCTTGTTAATATTATTTCTCGATTAGCTGTTAG
GGAAGCTGCAAGGACTAGTGTCCTTTCGAGTAGATGGAAATATTTGTGGA
CTTTTACGACTTGTCTTAACTTCAGTGCTTTGAAGATGCTGTGGAATGTT
AAAAAGGATCCTGCTACGTTAGAAGAAGAGAGGTATAATTACATTAATTG
GGTGAATGATGTCTTGGACTCGCATATGGGTTTATGTATTAATGAGTTTA
GATTGTGTTTTGAGTTGCGTAATTCTCATGGAAGCTTCATTACTCATTGG
ATTTTCACTGCACTAGCCAAGAAAGTTCAAAAGCTTGAGTTGAACTTGCA
CCCCGTTGGGGGAGGTTTCTGGCCGCCTCTTGAGCTTTACGCATTTCCGC
CAGAGTGCTTGAAATTGTTCCGCAGCCCCCGTACTTTGTCTAATATTAAG
TCTTTAAGATCTCTGTGTTTAGACGCTGTGAATGTTAGTGGAGAGGTTCT
TGAGTTTTTTATATACAGTTGTCCACTTTCTGCTCGATTGCGTGTGGGTC
TTTTCTT
back to top