FC870626
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC870626 vs. ExPASy Swiss-Prot
Match: RL72_ARATH (60S ribosomal protein L7-2 OS=Arabidopsis thaliana GN=RPL7B PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 6.319e-12 Identity = 32/46 (69.57%), Postives = 34/46 (73.91%), Query Frame = 3 Query: 3 EANNFLWPFXXXXXXXXXXXXRNHYVEGGDAGNREDYINELIRRMN 140 EANNFLWPF RNHYVEGGDAGNRE++INELIRRMN Sbjct: 197 EANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELIRRMN 242
BLAST of FC870626 vs. ExPASy Swiss-Prot
Match: RL74_ARATH (60S ribosomal protein L7-4 OS=Arabidopsis thaliana GN=RPL7D PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 8.253e-12 Identity = 31/46 (67.39%), Postives = 34/46 (73.91%), Query Frame = 3 Query: 3 EANNFLWPFXXXXXXXXXXXXRNHYVEGGDAGNREDYINELIRRMN 140 EANNFLWPF RNHYVEGGDAGNRE++INEL+RRMN Sbjct: 199 EANNFLWPFQLKAPLGGMKKKRNHYVEGGDAGNRENFINELVRRMN 244
BLAST of FC870626 vs. ExPASy Swiss-Prot
Match: RL73_ARATH (60S ribosomal protein L7-3 OS=Arabidopsis thaliana GN=RPL7C PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 8.253e-12 Identity = 31/46 (67.39%), Postives = 34/46 (73.91%), Query Frame = 3 Query: 3 EANNFLWPFXXXXXXXXXXXXRNHYVEGGDAGNREDYINELIRRMN 140 EANNFLWPF RNHYVEGGDAGNRE++INEL+RRMN Sbjct: 197 EANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELVRRMN 242 The following BLAST results are available for this feature:
BLAST of FC870626 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC870626 ID=FC870626; Name=FC870626; organism=Citrus clementina; type=EST; length=499bpback to top |